1. 1.      PENDAHULUAN

 

Kelistrikan merupakan sesuatu yang biasa di gunakan dalam kehidupan sehari-hari dan biasanya kita tidak terlalu banyak memikirkan hal tersebut. Walaupun pemakaian praktis dari kelistrikan telah dikembangkan khususnya pada abad keduapuluh, penelitian dibidang kelistrikan mempunyai sejarah yang panjang. Pengamatan terhadap gaya listrik dapat ditelusuri sampai pada zaman Yunani kuno. Orang-orang Yunani telah mengamati bahwa setelah batu amper digosok, batu tersebut akan menarik benda kecil seperti jerami atau bulu. Kata listrik berasal dari bahasa Yunani untuk amper yaitu electron.

 

Selama periode hujan badai pada tahun 1786, Luigi Galvani menyentuh otot tungkai seekor katak dengan menggunakan suatu metal, dan teramati bahwa otot katak tersebut berkontraksi. Dari pengamatan tersebut, ia menyimpulkan bahwa aliran listrik akibat badai tersebut merambat melalui saraf si katak sehingga otot-ototnya berkontraksi. Sel saraf menghantarkan impuls dari satu bagian tubuh ke bagian tubuh yang lain. Namun dengan mekanisme yang jauh berbeda dengan hantaran aliran listrik pada suatu konduktor metal. Dalam rentang waktu yang cukup lama, kita mengetahui implus dalam system saraf terdiri dari ion-ion yang mengalir sepanjang sel-sel saraf lebih lambat dan kekuatannya lebih rendah (konduksinya ada atau tidak sama sekali) dibandingkan konduksi pada metal.

Alessandro Volta meneliti fenomena ini dan, dalam prosesnya menemukan baterai salah satu penemuan terpenting dalam sejarah fisika. Temuan tersebut merupakan sumber arus listrik tetap yang pertama.

Kelistrikan memegang peranan penting dalam bidang kedokteran. Ada dua aspek kelistrikan dan magnetis dalam bidang kedokteran, yaitu listrik dan magnet yang timbul dalam tubuh manusia, serta penggunaan listrik dan magnet pada permukaan tubuh manusia. Listrik yang dihasilkan di dalam tubuh berfungsi untuk mengendalikan dan mengoperasikan saraf, otot dan berbagai organ. Kerja otak pada dasarnya bersifat elektrik.

 

  1. 2.      Hukum dalam Biolistrik

Hukum-hukum yang mendasari biolistrik antara lain adalah Hukum Ohm dan Hukum Joule.

Hukum Ohm menyatakan bahwa:

“ Menyatakan potensial antara ujung konduktor berbanding langsung dengan arus yang melewati, dan berbanding terbalik dengan tahanan dari konduktor”.

 

Rumus:

                        V

            R= 

                         I

R: hambatan (Ω)

I : Kuat arus (Ampere)

V: Tegangan (Volt)

 

Hukum joule menyatakan bahwa :

“Arus listrik yang melewati konduktor dengan beda potensial (V), dalam waktu tertentu akan menimbulkan panas”

 

Q= Energi panas yang ditimbulkan (Joule)

V= Tegangan (volt)

I = Arus (A)

t= waktu lamanya arus mengalir (second)

 

  1. 3.      Kelistrikan dan kemagnetan yang Timbul di dalam Tubuh
  2. Sistem Saraf dan Neuron

System Saraf dibagi menjadi dua, yaitu: system saraf pusat dan system saraf otonom.

Sistem Saraf Pusat terdiri dari dari otak, medulla spinalis dan saraf perifer. Saraf perifer ini adalah serat saraf yang mengirim informasi sensoris ke otak atau ke medulla spenalis, disebut saraf afferent. Sedangkan serat saraf yang menghantarkan informasi dari otak atau medulla spenalis ke otot dan kelenjar disebut saraf efferent.

Sistem Saraf Otonom :

Serat saraf ini mengatur organ dalam tubuh, misalnya jantung, usus dank kelenjar-kelenjar pengontrolan ini dilakukan secara tidak sadar.

 

Neuron

Struktur dasar system saraf disebut neuron/sel saraf. Suatu sel saraf (neuron) merupakan bagian terkecil dalam suatu skema saraf dan berfungsi menerima, menginterpretasikan (memakai) dan menghantarkan aliran listrik/informasi. Sel saraf terdiri dari tubuh secara serabut yang menyerupai ranting. Serabutnya juga terdiri dari 2 macam, yaitu dendrite dan akson.

 

Dendrit, bersama dengan tubuh sel berfungsi menerima informasi berupa rangsangan dan sensor berfungsi menghantarkan informasi ke bagian sel saraf lain. Jika rangsangan yang diterima oleh dendrite atau tubuh sel pada setiap waktu, intensitasnya berada pada ambang batas atau lebih, maka impuls saraf bereaksi serta menjalar sepanjang akson. Impuls ini akan mengalir sepanjang akson dari tubuh sel menuju cabang terminal.

 

Akson, merupakan suatu salinan panjang yang tipis dan pada ujungnya terbungkus oleh suatu membrane yang berisi cairan dengan nama aksoplasma. Sesampainya impuls saraf pada terminal, suatu substansi saraf penghantar dilepaskan dan akan menyampaikan impuls ke penerima di sel berikutnya.

 

Sel Saraf Dalam Keadaan Istirahat

Dalam suatu sel saraf maupun sel-sel hidup lainnya, membrane sel mempertahankan kondisi intraseluler yang berbeda dengan lingkungan ekstra selulernya. Setiap sel saraf menghasilkan sedikit ion negative tepat di dalam sel dan juga ion positif tepat di luar membrane sel.

 

Telah diketahui bahwa sel mempunyai lapisan yang di sebut membrane sel, di dalam sel terdapat ion Na+, K +, Cl, dan protein (A). perbedaan sifat electron pada membrane sel saraf adalah kunci dalam memahami hantaran impuls saraf. Konsentrasi ion Kalium (K+) di dalam cairan pada bagian dalam membrane sel 30 kali lebih banyak daripada yang di luar, sedangkan konsentrasi ion Natrium (Na+) sepuluh kali lebih banyak dibagian luar membrane sel dibandingkan dengan bagian dalam. Perlu di cermati bahwa semua anion (terutama klorida, Cl) juga tidak terdistribusi sempurna. Seperti pada sel hidup yang lain, sel saraf mengguanakan difusi pasif untuk mempertahankan perbedaan ini melalui membrane selnya. Ketidaksesuaian distribusi Na+  dan K+ sebenarnaya dibentuk oleh kebutuhan energi pemompaan Na+ -K+, yang memindahkan ion Nakeluar dari sel dan K+ ke dalam sel. Juga adanya suatu protein dalam membrane sel saraf sebagai suatu saluran potensial yang memudahkan Na+ dan K+ mengalir selama hantaran impuls saraf.

 

Suatu sel saraf berada dalam keadaan istirahat, saluran Na+ yang bergantung pada tegangan tertutup sehingga menjadi ketidaksamaan distribusi Na+. membrane sel saraf yang berbeda dalam keadaan istirahat (tidak adanya proses konduksi impuls listrik), konsentrasi ion Na+lebih banyak di luar sel dari pada dalam sel akan lebih negative dibandingkan dengan di luar sel. Dalam keadaan istirahat, membrane sel tidak permeable terhadap anion yang besar (atau terhadap jenis muatan negative besar lainnya, seperti protein) dengan demikian kelebihan muatan negative berbentuk tepat di bagian dalam permukaan membrane sel. Beda potensial (table 7.1) pada membrane sel sekitar 70 mV; dan potensial di dalam membrane sel- 70 mV. Membrane sel ini di sebut dalam keadaan polarisasi. Ini adalah potensial sel saraf dalam keadaan istirahat.

 

Table 7.1 konsentrasi ion di dalam dan di luar sel saraf istirahat yang umum.

Ion

Konsentrasi (mmol/L)

Di dalam

Di luar

Na+

K+

Cl

Lainnya

15

150

9

156

145

5

120

30

 

 

Rangsangan Sel Syaraf

Potensial sel syaraf  dalam keadaan istirahat dapat diganggu oleh rangsangan listrik kimi maupun mekanik, selanjutnya butir-butir membrane akan berubah dan butir-butir ion natrium akan masuk dari luar sel ke dalam sel. Didalam sel akan menjadi kurang negative atau lebih positif daripada di luar sel dan potensial membrane akan meningkat, keadaan membrane ini disebut depolarisasi.

Jika efek dari konsentrasi natrium (luar> dalam) menjadi seimbang oleh karena gradient listrik (potensial membrannya menjadi positif dari dalam) depolarisasi berakhir saluran natrium kemudian menutup kembali. Saluran kalium merespon perobahan polaritas membrane setelah pembukaan natrium dengan mengirimkan kalium keluar dan natrium kedalam. Setelah depolarisasi saluran natrium tetap tertutup untuk waktu yang xukup singkat sampai membrane sel syaraf tidak dapat dirangsang lagi dinamakan periode pemulihan. Perubahan transien pada potensial listrik di antara membrane dinyatakan sebagai potensial aksi. Potensial aksi merupakan penomena keseluruhan yang berarti bahwa begitu nilai ambang tercapai, peningkatan waktu dan amplitude dan potensial aksi selalu sama.

 

 

 

 

 

Perambatan impuls saraf

Karena adanya potensial aksi, sebagian kecil membrane mengalami depolarisasi akibat adanya aliran ion dalam membrane.

 

  1. 4.   Kelistrikan Otot Jantung

Sel membrane otot jantung (miokardium) sangat berbeda dengan syaraf dan otot bergaris dalam keadaan potensial istirahat dilakukan rangsangan maka ion-ion natrium akan masuk kedalam sel dan setelah tercapai nilai ambang akan timbul depolarisasi. Sedangkan pada sel otot jantung ion natrium mudah bocor.

 

  1. 5.   Elektrofisiologi Jantung

Aktivitas listrik jantung terjadi akibat ion (partikel bermuatan seperti natrium, kalium dan kalsium) bergerak menembus membran sel. Perbedaan muatan listrik yang tercatat dalam sebuah sel mengakibatkan apa yang dinamakan potensial aksi jantung.

Pada keadaan istirahat, otot jantung terdapat dalam keadaan repolarisasi artinya terdapat perbedaan muatan listrik antara bagian dalam membran yang bermuatan negatif dan bagian luar yang bermuatan positif. Siklus jantung bermula saat dilepaskannya impuls listrik, mulailah fase depolarisasi. Permeabilitas membran sel berubah dan ion bergerak melintasinya. Dengan bergeraknya ion ke dalam sel maka bagian dalam sel akan menjadi positif. Kontraksi otot terjadi setelah depolarisasi.sel otot jantung normalnya akan mengalami depolarisasi ketika sel-sel tetengganya mengalami depolarisasi (meskipun dapat juga terdepolarisasi akabat stimulasi listrik eksternal).depolarisasi sebuah sel sisrem hantaran khusus yang memadai akan mengakibatkan depolarisasi dan kontraksi seluruh miokardium.Repolarisasi terjadi saat sel kembali kekeadaan dasar (menjadi lebih negatif),dan sesuai dengan relaksasi otot miokardium.

Setelah influks natrium cepat ke dalam sel selama depolarisasi, permeabilitas membran sel terhadap kalsium akan berubah, sehingga memungkinkan ambilan kalsium ke dalam sel. Influks kalsium, yang terjadi selama fase plateau repolarisasi, jauh lebih lambat dibandingkan natrium dan berlangsung lebih lama. Interaksi antara perubahan voltase membran dan kontraksi otot di nbamkan kopling elektromekanikal.

Otot jantung,tidak seperti otot lurik atau otot polos,mempunyai periode refraktori yang panjang,pada saat sel tidak dapat distimulasi untuk berkontraksi.Hal tersebut melindungi jantung dari kontraksi berkepanjangan (tetani),yang dapat mengakibatkan henti jantung mendadak.

Kopling elektromekanikal dan kontraksi jantung yang normal tergantung pada komposisi cairan interstisialsekitar otot jantung.Komposisi cairan tersebut pada gilirannya tergantung pada komposisi darah.

Maka perubahan konsentrasi kalsium dapat mempengaruhi kontraksi serabut otot jantung. Perubahan konsentrasi kalium darah juga penting,karena kalium mempengaruhi voltase listrik normal sel.

 

  1. 6.   Aktivitas Kelistrikan Otot Jantung

Sel otot jantung mempunyai kemampuan menuntun suatu perambatan potensial aksi atau gelombang depolarisasi. Depolarisasi miokardium oleh perambatan potensial aksi akan menghasilkan kontraksi otot. Tiga hal penting sel otot jantung :

  1. Konduksi berjalan dengan kecepatan tinggi merupakan keistimewaan pada otot jantung dimana konduksi berlangsung secara cepat.
  2. Periode refragter yang cepat lamanya repolarisasi dan periode refragtor pada otot jantung.
  3. Otomatisasi, tidak menghendaki rangsangan dari luar untuk mencapai nilai ambang melainkan mempunyai kemampuan sendiri yaitu depolarisasi spontan tanpa rangsangan dari luar.

SA node mengalami gelombang depolarisasi ke atrium kiri ke atrium kanan. Gelombang depolarisasi diteruskan ke AV node sehingga AV node mengalami depolarisasi dilanjutkan melalui berkas his dan diteruskan ke berkas cabang sehingga mengalami depolarisasi, dari cabang bundle impuls tersebut di teruskan ke jaringan purkinye. Dari jaringan purkinye gelombang depolarisasi diteruskan ke endokardium dan berakhir ke epikardium sehingga terjadi kontraksi otot jantung.

Setelah repolarisasi, miokardium mengalami relaksasi. Pada waktu repolarisasi tampak proses epikardium ke endokardium ventrikel, sedangkan pada proses depolarisasi tampak dari endokardium ke epikardium.

 

  1. 7.   Sistem Konduksi Jantung

Di dalam otot jantung terdapat jaringan khusus yang menghantarkan aliran listrik. Jaringan tersebut mempunyai sifat-sifat yang khusus,yaitu :

  1. Otomatisasi,kemampuan untuk menimbulkan impuls secara spontan.
  2. Irama,kemampuan membentuk impuls yang teratur.
  3. Daya konduksi,kemampuan untuk menyalurkan impuls.
  4. Daya rangsang,kemampuan untuk bereaksi terhadap rangasang.

 

Berdasarkan sifat-sifat tersebut di atas,maka secara spontan dan teratur jantung akan menghasilkan impuls-impuls yang di salurkan melalui system hantaran untuk merangsang otot jantung dan bisa menimbulkan kontraksi otot. Perjalanan impuls di mulai dari nodus SA ke nodus AV,sampai ke serabut purkinye.

 

  • Serabut bachman

Serabut bachman merupakan jalur yang menghubungkan impuls listrik dari atrium kanan dengan atrium kiri.

 

  • Sinoatrial Node (SA Node)/ Pacemaker: sekumpulan masa kecil dari sel khusus yang terbentang pada dinding atrium kanan dekat pembukaan vena cava superior. Disebut pacemaker karena menginisiasi impuls menyebabkan kontraksi atrium dalam tempo 70 detik dan terjadi kontraksi atrium, disebut depolarisasi atrium. Pada keadaan normal, nodus ini mampu menghasilkan impuls listrik sebesar 60-100 kali per menit. Sesuai sifatnya sebagai sel pacemaker, nodus SA mampu menghasilkan impuls dengan sendirinya.

 

  • Atrioventrikular Node (AV Node): terdapat pada dinding atrial septum dekat katup atriventrikular. Menkonduksi impuls yang tiba melalui atria dan yang berasal dari SA Node. Disini terdapat delay, sinyal elektrik butuh 0,1 sekon untuk melewati ventrikel, menyebabkan atria selesai berkontraksi sebelum ventrikel mulai berkontraksi. AV Node juga memiliki fungsi secondary pacemaker, mengambil alih fungsi SA Node bila terjadi masalah, namun menjadi lebih lambat daripada SA Node. Dalam keadaan normal mampu menghasilkan impuls 40-60 kali per menit.
  • Atrioventrikular Bundle (AV Bundle atau Bundle of His): fiber khusus yang berasal dari AV Node. AV Bundle melintasi fibrous ring yang memisahkan atrium dan ventrikel, pada ujung atas sekat ventrikel, AV Bundle terbagi menjadi cabang bundle kanan dan kiri. Bersamaan dengan myocardium ventrikel, cabang-cabang membagi menjadi fiber halus yang disebut serat purkinje. AV bundle, cabang bundle, dan serat purkinje menghantarkan impuls elektrik dari AV node ke apex jantung dimana mulailahterjadi kontraksi ventrikel. Berkas his terbagi menjadi cabang berkas kiri (left bundle branches, LBB) dan berkas kanan (right bundle branches, RBB). LBB terbagi menjadi:
  1. 1.      Fasikulus posterior menghantarkan impuls listrik ke ventrikel kiri bagian inferior dan posterior.
  2. 2.      Fasikulus anterior menghantarkan impuls ke ventrikel kiri bagian anterior dan superior. RBB menghantarkan impuls listrik dari berkas his ke ventrikel kanan.
  • Serabut purkinje

Serabut purkinje terletak di dalam endokardium dan merupakan akhir dari perjalanan impuls listrik untuk disampaikan ke endokardium agar terjadi depolarisasi di kedua ventrikel. Serabut purkinje secara normal mampu menghasilkan impuls 20-40 kali per menit.

 

 

 

 

 

 

 

 

 

 

  1. 8.   Hubungan Sistem Konduksi dengan Gelombang EKG

Sistem konduksi listrik jantung (nodus SA, nodus AV, His, dan serabut purkinje) secara sistematis mampu menghasilkan gelombang elektrokardiografi dan menggerakkan jantung untuk melakukan kontraksi.
Ketika satu impuls dicetuskan oleh nodus SA, listrik lebih dulu menjalar di kedua atrium dan terjadilah depolarisasi. Selanjutnya, akan menghasilkan gelombang P pada rekaman EKG. Oleh karena potensial listrik akibat repolarisasi atrium lebih rendah daripada depolarisasi atrium, gelombang repolarisasi pada atrium tampak pada rekaman EKG. Selanjutnya, listrik yang sudah ada di atrium meneruskan penjalaran (konduksi) ke nodus AV, His, LBB dan RBB, dan berakhir di serabut purkinje. Sesampainya di serabut purkinje, impuls listrik mendepolarisasi otot-otot di kedua ventrikel yang lebih lanjut akan menghasilkan kontraksi kedua ventrikel. Peristiwa terjadinya depolarisasi pada kedua ventrikel ini menghasilkan gelombang QRS dan munculnya gelombang T merupakan akibat terjadinya peristiwa repolarisasi ventrikel.

Gelombang-gelombang yang timbul akibat depolarisasi dan repolarisasi miokardium itu akan direkam pada kertas EKG dan, seperti halnya setiap macam gelombang lainnya, mempunyai tiga sifat utama, yakni:

  1. Durasi, diukur dalam seperbagian detik
  2. Amplitudo, diukur dalam milivolts (mV)
  3. Konfigurasi, merupakan kriteria yang lebih subjektif sehubungan dengan bentuk dan gambaran sebuah gelombang.

Kertas EKG didesain dengan bentuk khusus yang masing-masing dibuat bergaris-garis membentuk sebuah kotak yang sama sisi. Masing-masing kotak terdiri atas kotak berukuran kecil ditandai garis tipis dan kotak besar bergaris tebal. Garis tipis membatasi kotak-kotak kecil seluas 1 mm X 1 mm; garis tebal membatasi kotak besar seluas 5 mm X 5 mm.
Sumbu horisontal mengukur waktu. Jarak satu kotak kecil adalah 0,04 detik. Jarak satu kotak besar adalah lima kali lebih besar, atau 0,2 detik. Sumbu vertikal mengukur voltage. Jarak satu kotak kecil adalah sebesar 0,1 mV, dan satu kotak besar adalah sebesar 0,5 mV.

 

 

a)   Perubahan Kelistrikan Jantung

Pada EKG normal, terdapat gelombang P,Q, R, S, T.

  • Gekombang P: muncul ketika ada impulse dari SA Node yang melewati atrium. Normalnya kurang dari 0,12 detik dan tingginya (amplitudo) tidak lebih dari 0,3 mV. Gelombang P secara normal selalu defleksi positif (cembung ke atas) di semua sadapan dan selalu defleksi negatif (cekung ke bawah) di sadapan aVR. Akan tetapi, kadang-kadang ditemukan defleksi negatif di sadapan V1 dan hal ini merupakan sesuatu yang normal.

 

  • Masa Jeda memisahkan Atrium dari Ventrikel

Pada jantung sehat, ada sebuah pintu gerbang listrik pada persambungan antara atrium dan ventrikel. Gelombang depolarisasi, yang telah menyelesaikan penrjalanannya melalui atrium, sekarang akan menemui suatu sawar (barrier). Di tempat tersebut, suatu struktur yang disebut nodus atrioventrikular (AV) yang akan memperlambat konduksi sampai menjadi lambat sekali. Masa istirahat ini hanya berlangsung selama seper detik. Perlambatan konduksi yang fisiologik ini berguna untuk mempermudah atrium menyelesaikan kontraksinya sebelum ventrikel mulai berkontraksi. Pemasangan kabel jantung yang rapi ini memungkinkan atrium mengosongkan seluruh volume darahnya ke dalam ventrikel sebelum ventrikel berkontraksi.

  • Kompleks QRS: Menggambarkan persebaran yang cepat dari AV Node melewati AV Bundle dan serat Purkinje dan aktivitas elektrik daripada otot ventrikel. Kompleks QRS merupakan gelombang kedua setelah gelombang P, terdiri atas gelombang Q-R dan/ atau S. gelombang QRS merupakan hasil depolarisasi yang terjadi di kedua ventrikel yang dapat direkam oleh mesin EKG. Secara normal, lebar kompleks QRS adalah 0,06-0,12 detik dengan amplitudo bervariasi bergantung pada sadapan.

 

  • Gelombang Q

Gelombang ini merupakan gelombang defleksi negatif setelah gelombang P. secara normal, lebarnya tidak lebih dari 0,04 detik. Bila lebarnya melebihi nilai normal, dinamakan Q patologis.

  • Gelombang R

Gelombang R merupakan gelombang defleksi positif (ke atas) setelah gelombang P atau setelah Q. Gelombang ini umumnya selalu positif di semua sadapan, kecuali aVR. Penampakannya di sadapan V1 dan V2 kadang-kadang kecil atau tidak ada, tetapi hal ini masih normal.

  • Gelombang S

Gelombang ini merupakan gelombang defleksi negatif (ke bawah) setelah gelombang R atau gelombang Q. secara normal, gelombang S berangsur-angsur menghilang pada sadapan V1-V6. gelombang ini sering terlihat lebih dalam di sadapan V1 dan aVR, dan ini normal.

  • Gelombang T: menggambarkan relaksasi dari otot ventrikel

Pada EKG SA Node=sinus rhytm, reratanya 60-100 denyut per menit. Bila meningkat terjadi takikardi, dan bila menurun bradikardi.

  • Gelombang T

Gelombang T merupakan gelombang hasil repolarisasi di kedua ventrikel. Normalnya, positif (ke atas) dan interved (terbalik) di aVR. Gelombang T yang interved selain di aVR merupakan indikasi adanya iskemia miokard. Gelombang T yang runcing di semua sadapan dapat membantu menegakkan adanya hiperkalemia, sedangkan gelombang T yang tinggi pada beberapa sadapan tertentu dapat menunjukkan adanya hiperakut T yang merupakan tanda awal sebelum infarl miokard terjadi.

  • Gelombang U

Gelombang U merupakan gelombang yang muncul setelah gelombang T dan sebelum gelombang P berikutnya. Umumnya merupakan suatu kelainan akibat hipokalemia.

 

 

  • Interval PR

Interval PR adalah garis horizontal yang diukur dari awal gelombang P hingga awal kompleks QRS. Interval ini menggabarkan waktu yang diperlukan dari permulaan depolarisasi atrium sampai awal depolarisasi ventrikel atau waktu yang diperlukan impuls listrik dari nodus SA menuju serabut purkinje, dan normalnya 0,12-0,20 detik.

  • Interval QT

Interval QT merupakan garis horizontal yang diawali dari gelombang Q sampai akhir gelombang T. interval ini merupakan waktu yang diperlukan ventrikel dari awal terjadinya depolarisasi sampai akhir repolarisasi. Batas normal interval QT pada laki-laki berkisar antara 0,42-0,44 detik, sedangkan pada wanita berkisar antara 0,43-0,47 detik.

  • Segmen ST

Segmen ST merupakan garis horizontal setelah akhir QRS sampai awal gelombang T. segmen ini merupakan waktu depolarisasi ventrikel yang masih berlangsung sampai dimulainya awal repolarisasi ventrikel. Normalnya, sejajar garis isoelektrik.
Segmen ST yang naik di atas isoelektrik dinamakan elevasi dan yang turun di bawah isoelektrik dinamakan ST depresi. ST elevasi dapat menunjukkan adanya suatu infark miokard dan ST depresi menunjukkan adanya iskemik miokard.

 

  1. 9.   Listrik Jantung
  2. Aliran arus listrik dari masa sinsitium otot jantung

Sebelum masa sisitium otot jantung terangsang semua bagian luar sel otot itu bermuatan positif dan bagian dalam bermuatan negatif. Begitu suatu daerah sinsitium jantung terdepolarisasi, muatan negative akan bocor keluar dari serabut otot yang mengalami depolarisasi sehingga daerah permukaan ini menjadi elektronegatif. Karena proses depolarisasi menyebar kesegala arah melalui jantung, perbedaan potensial yang tampak hanya menetap selama seperbeberapa ribu detik,dan perhitungan voltase yang sebenarnya hanya dapat dilakukan dengan alat perekam yang berkecepatan tinggi.

 

 

  1. Aliran arus listrik yang mengelilingi jantung pada dada (paru)

Walaupun sebagian besar paru terisi oleh udara tapi dapat juga menghantarkan arus listrik yang cukup besar dan cairan yang terdapat dalam jaringan lain yang terletak di sekeliling jantung juga dapat menghantarkan arus listrik dengan mudah. Oleh karena itu,sebenarnya jantung terendam di dalam media yang konduktif. Bila satu bagian ventrikal  mengalami depolarisasi maka daerah itu akan menjadi elektronegatif di bandingkan bagian lainnya. Aliran listrik akan mengalir dari daerah yang terdepolarisasi menuju ke daerah yang terpolarisasi melalui jalur melingkar yang besar.

 

Impuls jantung mula-mula akan sampai di bagian septum ventrikal dan selanjutnya segera menyebar ke permukaan dalam dari sisa ventrikel lainnya. Keadaan ini akan menyebabkan kenegatifan di bagian dalam ventrikel,sedangkan di bagian luar dinding ventrikel akan mengalami kepositifan,dengan arus listrik akan mengalir melalui cairan yang terdapat di sekeliling ventrikael menurut jalur elips. Dengan kata lain arus listik rata-rata dengan kenegatifan akan mengalir kebasal jantung dan arus listrik rata-rata dengan kepositifan akan mengalir ke bagian apeks.

 

Selama berlangsungnya sebagian besar sisa proses depolarisasi,arus juga tetap mengalir menurut arah penyebaran yang sama,sementara depolarisasi menyebar dari permukaan endokardium keluar melalui masa otot ventrikel.Kemudian,sesaat sebelum proses depolarisasi selesai melintasi ventrikel,selama kira-kira 0,01 detik,rata-rata aliran arus listrik ini akan terbalik,yakni akan mengalir dari apeks ventrikel menuju ke bagian basal,sebab bagian ja ntung yang paling akhir terdepolarisasi adalah dinding bagian luar ventrikel yang dekat dengan basal jantung.

 

Jadi pada ventrikel jantung yang normal,selama hampir seluruh siklus depolarisasi,arus mengalir dari negative ke positif,terutama dari arah basal jantung menuju ke apeks kecuali pada bagian akhir dari proses depolarisasi.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Daftar Pustaka

Krisna Sundana.(2002). Interpretasi EKG. Jakarta : EGC

Ahmadi Ruslan Hani dan Handoko Riwidikdo. (2009) .Fisika Kesehatan. Yogyakarta: Mitra Cendekia Press.

http://chandrarandy.wordpress.com/2011/05/03/fisiologi-sistem-kardiovaskuler/

 

Posted on by azwarajuar | Leave a comment

BAB 1

PENDAHULUAN

 

 

1,1. Latar belakang

Leukemia (Inggris / Kanada Inggris: leukemia) (leukos Yunani”λευκός”, ‘putih’; AIMA”αίμα”, “darah”) adalah kanker dari sumsum darah atau tulang dan ditandai oleh proliferasi abnormal  (produksi dengan perbanyakan) sel darah, sel darah biasanya putih (leukosit). Leukemia adalah istilah yang luas yang mencakup spektrum penyakit. Pada gilirannya, itu adalah bagian dari kelompok yang lebih luas penyakit disebut neoplasma hematologi.

Leukemia secara klinis dan patologis dibagi ke dalam berbagai kelompok besar. Pembagian pertama adalah antara akut”’dan”kronis”bentuk:

  • ””Leukemia akut ditandai oleh peningkatan cepat dari sel-sel darah yang belum matang. Berkerumun Hal ini membuat sumsum tulang tidak mampu memproduksi sel-sel darah yang sehat. Perawatan cepat dibutuhkan pada leukemia akut karena perkembangan yang cepat dan akumulasi sel-sel ganas, yang kemudian meluap ke dalam aliran darah dan menyebar ke organ tubuh lainnya. Bentuk akut leukemia adalah bentuk paling umum dari leukemia pada anak-anak.
  • ””Leukemia kronis dibedakan oleh berlebihan membangun relatif matang, tapi masih normal, sel darah putih. Biasanya mengambil bulan atau tahun untuk maju, sel-sel yang dihasilkan di tingkat yang lebih tinggi dari sel-sel normal, sehingga banyak sel darah putih abnormal dalam darah. Sedangkan leukemia akut harus segera diobati, bentuk kronis kadang-kadang dimonitor untuk beberapa waktu sebelum perawatan untuk memastikan efektivitas maksimum terapi. Leukemia kronis terutama terjadi pada orang tua, tetapi secara teoritis dapat terjadi pada setiap kelompok usia.

Selain itu, penyakit dibagi sesuai dengan yang jenis sel darah yang terkena. Perpecahan ini membagi leukemia limfositik leukemia limfoblastik ke atau””dan myeloid atau myelogenous leukemia:

  • Dalam leukemia limfositik lymphoblastic atau””, perubahan kanker terjadi dalam jenis sel sumsum yang biasanya terjadi pada limfosit bentuk, yang melawan infeksi sel sistem kekebalan. Leukemia limfositik Kebanyakan melibatkan subtipe spesifik dari limfosit, sel B.
  • Pada leukemia myeloid atau myelogenous””, perubahan kanker terjadi dalam jenis sel sumsum yang biasanya berlangsung untuk membentuk sel darah merah, beberapa jenis sel darah putih lainnya, dan trombosit.

Menggabungkan kedua klasifikasi menyediakan total empat kategori utama:

Empat jenis utama leukemia

Tipe sel

Akut

Kronis

Lymphocytic leukemia 
(Atau “lymphoblastic”)

Leukemia limfoblastik akut (ALL)

Leukemia limfositik kronis (CLL)

Myelogenous leukemia 
(Juga “myeloid” atau “nonlymphocytic”)

Myelogenous akut leukemia (AML)

Myelogenous kronis leukemia (CML)

dalam kategori-kategori utama, ada biasanya beberapa subkategori. Akhirnya, leukemia sel berbulu dan T-cell leukemia prolymphocytic biasanya dianggap berada di luar dari skema klasifikasi.

 

 

 

 

 

 

BAB 2

KONSEP DASAR

 

2.1. Definisi Leukimia

Leukemia adalah jenis kanker yang mempengaruhi sumsum tulang dan jaringan getah bening. Semua kanker bermula di sel, yang membuat darah dan jaringan lainnya. Biasanya, sel-sel akan tumbuh dan membelah diri untuk membentuk sel-sel baru yang dibutuhkan tubuh. Saat sel-sel semakin tua, sel-sel tersebut akan mati dan sel-sel baru akan menggantikannya.

Tapi, terkadang proses yang teratur ini berjalan menyimpang, Sel-sel baru ini terbentuk meski tubuh tidak membutuhkannya, dan sel-sel lama tidak mati seperti seharusnya. Kejanggalan ini disebut leukemia, di mana sumsum tulang menghasilkan sel-sel darah putih abnormal yang akhirnya mendesak sel-sel lain.

 

2.2. Konsep stress dan stressor

 

Stres sebagai interaksi dan transaksi antara individu dengan lingkungan. Pendekatan ini telah dibatasi sebagai “ model psikologi”. Varian dari model psikologi ini didominasi teori stres kontemporer dan terdapat dua tipe tegas yang dapat diidentifikasi: interaksional dan transaksional. Menggambarkan stres sebagai suatu proses yang meliputi stresor dan strain (ketegangan) dengan menambahkan dimensi hubungan antara individu dengan lingkungan. Interaksi antara manusia dengan lingkungan yang saling mempengaruhi disebut sebagai hubungan transaksional yang didalamnya terdapat proses penyesuaian. Stres bukan hanya suatu stimulus atau sebuah respons saja, tetapi suatu agent yang aktif yang dapat mempengaruhi stresor melalui strategi perilaku, kognitif dan emosional. Individu akan memberikan reaksi stres yang berbeda pada stresor yang sama.

Stres sebagai suatu respons biologis. Hal ini sesuai dengan pemikiran Selye bahwa stres berfokus pada reaksi seseorang terhadap stresor dan mengambarkan stres sebagai suatu respons. Respons yang dialami itu mengandung dua komponen yaitu komponen psikologis (meliputi perilaku, pola pikir, emosi dan perasaan stres) dan komponen fisiologis (berupa rangsangan-rangsangan fisik yang meningkat). Selye mengemukakan respons tubuh terhadap stres tersebut sebagai “Stress Syndrome” atau “General Adaptation Syndrome (GAS)” yang merupakan respons umum dari tubuh. GAS menurut Selye terjadi saat organisme mengalami stres yang panjang atau lama dan organ tubuh yang lain juga ikut dipengaruhi oleh kondisi stres tersebut. Selye (1983) membagi stressor dalam beberapa tahap:

 

1. Alarm Stage

Merupakan reakisi awal tubuh dalam menghadapi berbagai stresor. Reaksi ini mirip dengan fight or flight response. Tubuh tidak dapat mempertahankan tahap ini untuk jangka waktu lama.

2. Adaptation stage (Eustress)

Tubuh mulai beradaptasi dengan adanya stres dan berusaha mengatasi dan membatasi stresor. Ketidakmampuan beradaptasi akan berakibat orang menjadi lebih rentan terhadap penyakit (disebut penyakit adaptasi).

3. Exhaustion (distress) stage

Tahap dimana adaptasi tidak bisa dipertahankan, disebabkan karena stres yang berulang atau berkepanjangan sehingga stres berdampak pada seluruh tubuh.

 

2.2. Perkembangan Psikoneuroimunologi

Perkembangan Psikoneuroimunologi di Indonesia diawali oleh penelitian Putra dkk (1992) pengaruh latihan dan Respons imun dilanjutkan pada tahun 1993 meneliti tentang pengaruh latihan fisik dan kondisi kejiwaan terhadap ketahanan tubuh. Penelitian tersebut berdasar pada konsep psikoneuroimunologi. Hasil dari penelitian tersebut menunjukkan bahwa latihan fisik yang dilakukan secara teratur dengan dosis yang intermiten dan dilakukan dalam kondisi yang menyenangkan akan meningkatkan respons imunitas, yaitu peningkatan IgM, IgG, IgA, monosit, subset T4 (helper), estrogen, kortisol, testosterone dan ACTH.

Mekanisme peningkatan ketahanan tubuh secara psikoneuroimunologi dapat dilihat dengan menghubungkan perubahan yang terjadi pada hormon dan neuropeptida yang melibatkan faktor kondisi kejiwaan (stres) dalam mekanisme perubahan ketahanan tubuh. Kondisi kejiwaan tersebut digambarkan sebagai status emosi yang mencerminkan dasar konsep kelainan mental.

Berdasar pada pemahaman konsep diatas, maka Psikoneuroimunologi merupakanneologisme (istilah baru) yang menggambarkan discipline hybride, yang mempunyai paradigma tersendiri, yaitu imunoregulasi tidak otonom. 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

KONSEP KEPERAWATAN

 

3.1  Pengkajian dan Masalah Keperawatan

Leukemia atau yang lebih dikenal sebagai kanker darah adalah salah satu jenis penyakit kanker. Leukemia disebabkan karena meningkatnya jumlah sel darah putih dalam darah atau sumsum tulang. Karena jumlahnya yang meningkat,  sel-sel darah putih yang sebetulnya tidak normal tersebut menggantikan sel darah yang normal. Ketidaknormalan ini membuat fungsi sel terganggu.

Tabel 1.1: Pengelompokan Masalah Keperawatan Pasien leukimia (menurut Teori Adaptasi)

Masalah Fisik

Masalah Psikis

Masalah Sosial

Masalah Ketergantungan

1. Sistem Pernapasan: Dyspnea, TBC, Pneumonia)

2. Sistem Pencernaan (Nausea-Vomiting, Diare, Dysphagia, BB turun 10%/3 bulan)

3. Sistem Persarafan: letargi, nyeri sendi, encepalopathy.

4. Sistem Integumen: Edema yg disebabkan Kaposis Sarcoma, Lesi di kulit atau mukosa, Alergi.

5. Lain – lain : Demam,

– Intergritas Ego:

Perasaan tak berdaya/ putus asa

– Faktor stress: baru/ lama

– Respons psikologis:

Denial, marah,

Cemas, irritable

 

Perasaan minder dan tak berguna di masyarakat

Interaksi Sosial:

-Perasaan terisolasi/ ditolak

Perasaan membutuhkan pertolongan orang lain

                        

                     

3.2.  Respons Adaptif Psikososial – Spiritual                                                

3.3.1.   Respons Adaptif Psikologis (penerimaan diri)

Pengalaman suatu penyakit akan membangkitkan berbagai perasaan dan reaksi stres, frustasi, kecemasan, kemarahan, penyangkalan, rasa malu, berduka dan ketidak pastian menuju pada adaptasi terhadap penyakit.

Tahapan reaksi psikologis pasien leukemia (Grame Stewart, 1997) adalah seperti terlihat pada tabel berikut:

Tabel 1.2. Reaksi Psikologis Pasien leukimia

Reaksi

Proses psikologis

Hal-hal yang biasa di jumpai

1. Shock (kaget, goncangan batin)

Merasa bersalah, marah, tidak berdaya

Rasa takut, hilang akal, frustrasi, rasa sedih, susah, acting out

2. Mengucilkan diri

Merasa cacat dan tidak berguna, menutup diri

Khawatir menginfeksi orang lain, murung

3. Membuka status secara terbatas

Ingin tahu reaksi orang lain, pengalihan stres, ingin dicintai

Penolakan, stres, konfrontasi

4. mencari orang lain yang leukimia

Berbagi rasa, pengenalan, kepercayaan, penguatan, dukungan sosial

Ketergantungan, campur tangan, tidak percaya pada pemegang rahasia dirinya

5. Status khusus

 

                             

 

 

 

 

Perubahan keterasingan menjadi manfaat khusus, perbedaan menjadi hal yang istmewa, dibutuhkan oleh yang lainnya

Ketergantungan, dikotomi kita dan mereka (sema orang dilihat sebagai penderita leukemia dan direspon seperti itu), over identification

Reaksi

Proses psikologis

 

Hal-hal yang biasa di jumpai

6. Penerimaan

Integrasi penderita leukimia  dengan identitas diri, keseimbangan antara kepentingan orang lain dengan diri sendiri, bisa menyebutkan kondisi seseorang

Apatis, sulit berubah.

 

Respons Psikologis (penerimaan diri) terhadap Penyakit menurut Kubler Ross (1974):

a. Pengingkaran (denial)

Pada tahap pertama pasien menunjukkan karakteristik perilaku pengingkaran, mereka gagal memahami dan mengalami makna rasional dan dampak emosional dari diagnosa. Pengingkaran ini dapat disebabkan karena ketidaktahuan pasien terhadap sakitnya atau sudah mengetahuinya dan mengancam dirinya. Pengingkaran dapat dinilai dari ucapan pasien “saya di sini istirahat.” Pengingkaran dapat berlalu sesuai dengan kemungkinan memproyeksikan pada apa yang diterima sebagai alat yang berfungsi sakit, kesalahan laporan laboratorium, atau lebih mungkin perkiraan dokter dan perawat yang tidak kompeten. Pengingkaran diri yang mencolok tampak menimbulkan kecemasan, pengingkaran ini merupakan buffer untuk menerima kenyataan yang sebenarnya. Pengingkaran biasanya bersifat sementara dan segera berubah menjadi fase lain dalam menghadapi kenyataan (Achir Yani, 1999).

 

b. Kemarahan (anger)

Apabila pengingkaran tidak dapat dipertahankan lagi, maka fase pertama berubah menjadi kemarahan. Perilaku pasien secara karakteristik dihubungkan dengan marah dan rasa bersalah. Pasien akan mengalihkan kemarahan pada segala sesuatu yang ada disekitarnya. Biasanya kemarahan diarahkan pada dirinya sendiri dan timbul penyesalan. Yang menjadi sasaran utama atas kemarahan adalah perawat, semua tindakan perawat serba salah, pasien banyak menuntut, cerewet, cemberut, tidak bersahabat, kasar, menantang, tidak mau bekerja sama, sangat marah, mudah tersinggung, minta banyak perhatian dan iri hati. Jika keluarga mengunjungi maka menunjukkan sikap menolak, yang mengakibatkan keluarga segan untuk datang, hal ini akan menyebabkan bentuk keagresipan (Hudak & Gallo, 1996).

 

c. Sikap tawar menawar (bargaining)

Setelah marah-marah berlalu, pasien akan berfikir dan merasakan bahwa protesnya tidak ada artinya. Mulai timbul rasa bersalahnya dan mulai membina hubungan dengan Tuhan, meminta dan berjanji merupakan ciri yang jelas yaitu pasien menyanggupi akan menjadi lebih baik bila terjadi sesuatu yang menimpanya atau berjanji lain jika dia dapat sembuh (Achir Yani, 1999).

 

d. Depresi

Selama fase ini pasien sedih/ berkabung mengesampingkan marah dan pertahanannya serta mulai mengatasi kehilangan secara konstruktif. Pasien mencoba perilaku baru yang konsisten dengan keterbatasan baru. Tingkat emosional adalah kesedihan, tidak berdaya, tidak ada harapan, bersalah, penyesalan yang dalam, kesepian dan waktu untuk menangis berguna pada saat ini. Perilaku fase ini termasuk mengatakan ketakutan akan masa depan, bertanya peran baru dalam keluarga intensitas depresi tergantung pada makna dan beratnya penyakit (Netty, 1999).

 

e. Penerimaan dan partisipasi

Sesuai dengan berlalunya waktu dan pasien beradapatasi, kepedihan dari kesabatan yang menyakitkan berkurang dan bergerak menuju identifikasi sebagai seseorang yang keterbatasan karena penyakitnya dan sebagai seorang cacat. Pasien mampu bergantung pada orang lain jika perlu dan tidak membutuhkan dorongan melebihi daya tahannya atau terlalu memaksakan keterbatasan atau ketidakadekuatan (Hudak & Gallo, 1996).

Proses ingatan jangka panjang yang terjadi pada keadaan stres yang kronis akan menimbulkan perubahan adaptasi dari jaringan atau sel. Adaptasi dari jaringan atau sel imun yang memiliki hormon kortisol dapat terbentuk bila dalam waktu lain menderita stres, dalam teori adaptasi dari Roy dikenal dengan mekanisme regulator.

              

               

3.3.2.  Respons Adaptif Spiritual

Respons Adaptif Spiritual dikembangkan dari konsep Ronaldson (2000) dan Kauman & Nipan (2003).

Respons adaptif Spiritual, meliputi:

1. Harapan yang realistis

2. Tabah dan sabar                  

3. Pandai mengambil hikmah 

 

3.2.  Diagnosis Keperawatan Pada leukimia

1. Resiko tinggi infeksi berhubungn dengan menururnnya sistem pertahanan tubuh sekunder gangguan pematangan SDP, peningkatan jumlah limfosit immatur, imunosupresi, peneknan sumsum tulang.

2. Resiko tinggi kekurangan volume cairan berhubungan dengan kehilangan berlebihan : muntah, perdarahan,diare ; penurunan pemasukan cairan : mual,anoreksia ; peningkatan kebutuhan cairan : demam, hipermetabolik

3. Nyeri berhubungan dengan agen fisikal seperti pembesaran organ/nodus limfe, sumsum tulang yang dikemas dengan sel leukemia; agen kimia pengobatan antileukemik.

4. Intoleransi aktivitas berhubungan dengan kelemahan umum, peningkatan laju metabolik
5. Resiko terjadi perdarahan berhubungan dengan trombositopenia

6. Perubahan perfusi jaringan berhubungan dengan terhentinya aliran darah sekunder adanya destruksi SDM

 

3.4. Intervensi Keperawatan Pasien leukimia

Prinsip Asuhan keperawatan pasien leukimia dalam mengubah perilaku dalam perawatan dan meningkatkan pemenuhan kebutuhan fisik, psikologis, sosial, dan spiritual perawat dalam menurunkan stresor. Pasien yang didiagnosis dengan leukimia mengalami stres persepsi (kognisi: penerimaan diri, sosial, dan spiritual) dan respons biologis selama menjalani perawatan di rumah sakit dan di rumah (home care). Peran perawat dalam perawatan pasien leukimia  adalah melaksanakan pendekatan Asuhan Keperawatan agar pasien dapat beradaptasi dengan cepat. Antara lain adalah:

1.  Memfasilitasi strategi koping

a. Memfasilitasi sumber penggunaan potensi diri agar terjadi respons penerimaan sesuai tahapan dari Kubler-Ross

b. Teknik Kognitif, penyelesaian masalah; harapan yang realistis; dan pandai mengambil hikmah

c. Teknik Perilaku, mengajarkan perilaku yang mendukung kesembuhan: kontrol & minum obat teratur; konsumsi nutrisi seimbang; istirahat dan aktifitas teratur; dan menghindari konsumsi atau tindakan yang menambah parah sakitnya

 

2. Dukungan sosial

a. . dukungan emosional, pasien merasa nyaman; dihargai; dicintai; dan diperhatikan

b. dukungan informasi, meningkatnya pengetahuan dan penerimaan pasien terhadap sakitnya

c. dukungan material, bantuan / kemudahan akses dalam pelayanan kesehatan pasien

                                               

3.5.. Asuhan keperawatan respon adaptif psikologis (strtegi koping)

Mekanisme koping adalah mekanisme yang digunakan individu untuk menghadapi perubahan yang diterima. Apabila mekanisme koping berhasil, maka orang tersebut akan dapat beradaptasi terhadap perubahan tersebut. Mekanime koping dapat dipelajari, sejak awal timbulnya stresor dan orang menyadari dampak dari stresor tersebut (Carlson, 1994). Kemampuan koping dari individu tergantung dari temperamen, persepsi, dan kognisi serta latar belakang budaya/norma dimana dia dibesarkan (Carlson, 1994).

Mekanisme koping terbentuk melalui proses belajar dan mengingat. Belajar disini adalah kemampuan menyesuaikan diri (adaptasi) pada pengaruh faktor internal dan eksternal (Nursalam, 2003). Menurut Roy, yang dikutip oleh Nursalam (2003) mekanisme belajar merupakan suatu proses didalam sistem adaptasi (cognator) yang meliputi mempersepsikan suatu informasi, baik dalam bentuk implisit maupun eksplisit. Belajar implisit umumnya bersifat reflektif dan tidak memerlukan kesadaran (focal) sebagaimana terlihat pada gambar. Keadaan ini ditemukan pada perilaku kebiasaan, sensitisasi dan keadaan. Pada habituasi timbul suatu penurunan dari transmisi sinap pada neuron sensoris sebagai akibat dari penurunan jumlah neurotransmitter yang berkurang yang dilepas oleh terminal presinap (Bear, 1996; Notosoedirdjo, 1998). Pada habituasi menuju ke depresi homosinaptik untuk suatu aktivitas dari luar yang terangsang terus menerus (Bear, 1996). Sensitifitas sifatnya lebih kompleks dari habituasi, mempunyai potensial jangka panjang (beberapa menit sampai beberapa minggu).

Koping yang efektif menempati tempat yang central terhadap ketahanan tubuh dan daya penolakan tubuh terhadap gangguan maupun serangan suatu penyakit baik bersifat fisik maupun psikis, sosial, spiritual. Perhatian terhadap koping tidak hanya terbatas pada sakit ringan tetapi justru penekanannya pada kondisi sakit yang berat (Notosoedirdjo M, 1998 & Keliat, 1999).

Lipowski membagi koping dalam 2 bentuk , yaitu coping style dan coping strategyCoping style merupakan mekanisme adaptasi individu meliputi mekanisme psikologis dan mekanisme kognitif dan persepsi. Sifat dasar coping style adalah mengurangi makna suatu konsep yang dianutnya, misalnya penolakan atau pengingkaran yang bervariasi yang tidak realistis atau berat (psikotik) hingga pada tingkatan yang sangat ringan saja terhadap suatu keadaan.

Coping strategy merupakan koping yang digunakan individu secara sadar dan terarah dalam mengatasi sakit atau stresor yang dihadapinya. Terbentuknya mekanisme koping bisa diperoleh melalui proses belajar dalam pengertian yang luas dan relaksasi. Apabila individu mempunyai mekanisme koping yang efektif dalam menghadapi stresor, maka stresor tidak akan menimbulkan stres yang berakibat kesakitan (disease), tetapi stresor justru menjadi stimulan yang mendatangkan wellness dan prestasi.

 

a. Strategi Koping (Cara Penyelesaian Masalah)

Beradaptasi terhadap penyakit memerlukan berbagai strategi tergantung ketrampilan koping yang bisa digunakan dalam menghadapi situasi sulit. Menurut Mooss (1984) yang dikutip Brunner dan Suddarth menguraikan tujuh koping yang negatif kategori keterampilan.

 

a.       Koping yang negatif

1.   Penyangkalan (avoidance)

Penyangkalan meliputi penolakan untuk menerima atau menghargai keseriusan penyakit. Pasien biasanya menyamarkan gejala yang merupakan bukti suatu penyakit atau mengacuhkan beratnya diagnosis penyakit dan penyangkalan ini merupakan mekanisme pertahanan ego yang melindungi terhadap kecemasan.

2.   Menyalahkan diri sendiri (self-blame). Koping ini muncul sebagai reaksi terhadap suatu  keputusasaan. Pasien merasa bersalah dan semua yang terjadi akibat dari perbuatannya.

3.   Pasrah (wishfull thinking). Pasien merasa pasrah terhadap masalah yang menimpanya tanpa adanya usaha dan motivasi untuk menghadapinya.

 

b. Mencari informasi

Keterampilan koping dalam mencari informasi mencakup

  1. Mengumpulkan informasi yang berkaitan yang dapat menghilangkan

kecemasan yang disebabkan oleh salah konsepsi dan ketidakpastian.

2.   Menggunakan sumber intelektual secara efektif

Pasien sering merasa terhibur oleh informasi mengenai penyakit, pengobatan dan perjalanan penyakit yang diperkirakan terjadi.

 

c. Meminta dukungan emosional

Kemampuan untuk mendapat dukungan emosional dari keluarga, sahabat dan pelayanan kesehatan sementara memelihara rasa kemampuan diri sangat penting. Koping ini bermakna untuk meraih bantuan dari orang lain sehingga akan memelihara harapan melalui dukungan.

 

d. Pembelajaran perawatan diri

Belajar merawat diri sendiri menunjukkan kemampuan dan efektifitas seseorang, ketidakberdayaan seseorang akan berkurang karena rasa bangga dalam percepatan membantu memulihkan dan memelihara harga diri.

 

e. Menetapkan tujuan kongkrit, terbatas

Keseluruhan tugas beradaptasi terhadap penyakit serius tampak membingungkan pada awalnya namun tugas tersebut dapat dikuasai dengan membagi-bagi tugas tersebut menjadi tujuan yang lebih kecil dan dapat ditangani akhirnya mengarah pada keberhasilan. Hal ini dapat dilaksanakan bila motivasi tetap dijaga dan perasaan tidak berdaya dikurangi.

 

 

 

f. Mengulangi hasil alternatif

Selalu saja ada alternatif lain dalam setiap situasi, dengan memahami pilihan tersebut akan membatu pasien merasa berjurang ketidakberdayaannya. Dengan menggali pilihan tersebut bersama perawat dalam keluarga akan membatu membuka realitas sebagai dasar untuk membuat keputusan selanjutnya. Koping ini membantu pasien mengurangi kecemasan dengan cara mempersiapkan hari esok dengan mengingat kembali bagaimana pasein mampu mengatasi kesulitan masa lalu dan meningkatkan percaya diri.

 

g. Menemukan makna dari penyakit

Penyakit merupakan satu pengalaman manusia kebanyakan orang menganggap penyakit serius sebagai titik balik kehidupan mereka baik spiritual maupun fisiologis, terkadang orang menemukan kepuasan dalam kepercayaan mereka bahwa pasien mungkin mempunyai makna atau berguna bagi orang lain. Mereka dapat berpartisipasi dalam proyek penelitian atau program latihan untuk saat ini, keluarga dapat berkumpul akibat adanya penyakit meskipun menyakitkan namun dengan cara sangat berarti.

 

b. Koping yang positif (Teknik Koping)

Ada 3 teknik koping yang ditawarkan dalam mengatasi stress:

  1. a.  Pemberdayaan Sumber Daya Psikologis (Potensi diri)

Sumber daya psikologis merupakan kepribadian dan kemampuan individu dalam memanfaatkannya menghadapi stres yang disebabkan situasi dan lingkungan (Pearlin & Schooler, 1978:5). Karakterisik di bawah ini merupakan sumber daya psikologis yang penting.

1. Pikiran yang positif tentang dirinya (harga diri)

Jenis ini bermanfaat dalam mengatasi situasi stres, sebagaimana teori dari Colley’s looking-glass self: rasa percaya diri, dan kemampuan untuk mengatasi masalah yg dihadapi.

2. Mengontrol diri sendiri

Kemampuan dan keyakinan untuk mengontrol tentang diri sendiri dan situasi (internal control) dan external control (bahwa kehidupannya dikendalikan oleh keberuntungan, nasib, dari luar) sehingga pasien akan mampu mengambil hikmah dari sakitnya (looking for silver lining)

Kemampuan mengontrol diri akan dapat memperkuat koping pasien, perawat harus menguatkan kontrol diri pasien dengan melakukan:

1. Membantu pasien mengidentifikasi masalah dan seberapa jauh dia dapat mengontrol diri

2. Meningkatkan perilaku menyeleseaikan masalah

3. Membantu meningkatkan rasa percaya diri, bahwa pasien akan mendapatkan hasil yang lebih baik

4. Memberi kesempatan kepada pasien untuk mengambil keputusan terhadap dirinya

5. Mengidentifikasi sumber-sumber pribadi dan lingkungan yang dapat meningkatkan kontrol diri: keyakinan, agama

 

  1. Rasionalisasi (Teknik Kognitif)

Upaya memahami dan mengiterpretasikan secara spesifik terhadap stres dalam mencari arti dan makna stres (neutralize its stressfull). Dalam menghadapi situasi stres, respons individu secara rasional adalah dia akan menghadapi secara terus terang, mengabaikan, atau memberitahukan kepada diri sendiri bahwa masalah tersebut bukan sesuatu yang penting untuk dipikirkan dan semuanya akan berakhir dengan sendirinya. Sebagaian orang berpikir bahwa setiap suatu kejadian akan menjadi sesuatu tantangan dalam hidupnya. Sebagian lagi menggantungkan semua permasalahan dengan melakukan kegiatan spiritual, lebih mendekatkan diri kepada sang pencipta untuk mencari hikmah dan makna dari semua yang terjadi.

 

  1. Teknik Perilaku

Teknik perilaku dapat dipergunakan untuk membantu individu dalam mengatasi situasi stres. Beberapa individu melakukan kegiatan yang bermanfaat dalam menunjang kesembuhannya. Misalnya, pasien HIV akan melakukan aktivitas yang dapat membantu peningkatan daya tubuhnya dengan tidur secara teratur, makan seimbang, minum obat anti retroviral dan obat untuk infeksi sekunder secara teratur, tidur dan istirahat yang cukup, dan menghindari konsumsi obat-abat yang memperparah keadan sakitnya.

 

 

 

 

3.6. Asuhan Keperawatan Respons Spiritual

Asuhan keperawatan pada aspek spiritual ditekankan pada penerimaan pasien terhadap sakit yang dideritanya (Ronaldson, 2000). Sehingga pasien leukimia akan dapat menerima dengan ikhlas terhadap sakit yang dialami dan mampu mengambil hikmah. Asuhan keperawatan yang dapat diberikan adalah:

a. Menguatkan harapan yang realistis kepada pasien terhadap kesembuhan

\Harapan merupakan salah satu unsur yang penting dalam dukungan sosial. Orang bijak mengatakan “hidup tanpa harapan, akan membuat orang putus asa dan bunuh diri”. Perawat harus meyakinkan kepada pasien bahwa sekecil apapun kesembuhan, misalnya akan memberikan ketenangan dan keyakinan pasien untuk berobat.

 

b. Pandai mengambil hikmah

Peran perawat dalam hal ini adalah mengingatkan dan mengajarkan kepada pasien untuk selalu berfikiran positif terhadap semua cobaan yang dialaminya. Dibalik semua cobaan yang dialami pasien, pasti ada maksud dari Sang Pencipta. Pasien harus difasilitasi untuk lebih mendekatkan diri kepada Sang Pencipta dengan jalan melakukan ibadah secara terus menerus. Sehingga pasien diharapkan memperoleh suatu ketenangan selama sakit.

 

c. Ketabahan hati

Karakteristik seseorang didasarkan pada keteguhan dan ketabahan hati dalam menghadapi cobaan. Individu yang mempunyai kepribadian yang kuat, akan tabah dalam menghadapi setiap cobaan. Individu tersebut biasanya mempunyai keteguhan hati dalam menentukan kehidupannya.

Ketabahan hati sangat dianjurkan kepada penderita leukimia. Perawat dapat menguatkan diri pasien dengan memberikan contoh nyata dan atau mengutip kitab suci atau pendapat orang bijak; bahwa Tuhan tidak akan memberikan cobaan kepada umatNYA. Pasien harus diyakinkan bahwa

semua cobaan yang diberikan pasti mengandung hikmah, yang sangat penting dalam kehidupannya.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

BAB 4

KESIMPULAN DAN SARAN

 

 

 

4.1. Kesimpulan

Leukemia adalah jenis kanker yang mempengaruhi sumsum tulang dan jaringan getah bening. Semua kanker bermula di sel, yang membuat darah dan jaringan lainnya. Biasanya, sel-sel akan tumbuh dan membelah diri untuk membentuk sel-sel baru yang dibutuhkan tubuh. Saat sel-sel semakin tua, sel-sel tersebut akan mati dan sel-sel baru akan menggantikannya.

Tapi, terkadang proses yang teratur ini berjalan menyimpang, Sel-sel baru ini terbentuk meski tubuh tidak membutuhkannya, dan sel-sel lama tidak mati seperti seharusnya. Kejanggalan ini disebut leukemia, di mana sumsum tulang menghasilkan sel-sel darah putih abnormal yang akhirnya mendesak sel-sel lain.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

DAFTAR PUSTAKA

 

–          Dr. Nursalam, M.Nurs (Hons), Ninuk Dian K, S.Kep.Ners, Asuhan Keperawatan Pada Pasien Terinfeksi HIV, Salemba Medika, Jakarta 2007

–          Nursalam, S.Kep.Ners dkk, Jurnal Keperawatan edisi bulan November,Fakultas Keperawatan Universitas Airlangga 2007.

 

Posted on by azwarajuar | Leave a comment
  1. PATIENT SAFETY ( UNIVERSAL / ISOLATED PRECATION )
    1. Pengertian Patient Safety

 Patient Safety atau keselamatan pasien adalah suatu system yang membuat asuhan pasien di rumah sakit menjadi lebih aman.

Sistem ini mencegah terjadinya cedera yang disebabkan oleh kesalahan akibat melaksanakan suatu tindakan atau tidak mengambil tindakan yang seharusnya diambil.

 

  1. Tujuan Patient Safety

Tujuan “Patient safety” adalah

1)      Terciptanya budaya keselamatan pasien di RS

2)      Meningkatnya akuntabilitas rumah sakit thdp pasien dan masyarakat;

3)      Menurunnya KTD di RS

4)      Terlaksananya program-program pencegahan shg tidak terjadi pengulangan KTD.

 

  1. Langkah-Langkah Pelaksanaan Patient Safety

        Pelaksanaan “Patient safety” meliputi

–          Sembilan solusi keselamatan Pasien di RS (WHO Collaborating Centre for Patient Safety, 2 May 2007), yaitu:

1)      Perhatikan nama obat, rupa dan ucapan mirip (look-alike, sound-alike medication names)

2)      Pastikan identifikasi pasien

3)      Komunikasi secara benar saat serah terima pasien

4)      Pastikan tindakan yang benar pada sisi tubuh yang benar

5)      Kendalikan cairan elektrolit pekat

6)      Pastikan akurasi pemberian obat pada pengalihan pelayanan

7)      Hindari salah kateter dan salah sambung slang

8)      Gunakan alat injeksi sekali pakai

9)      Tingkatkan kebersihan tangan untuk pencegahan infeksi nosokomial.

 

  1. Tujuh Standar Keselamatan Pasien (mengacu pada “Hospital Patient Safety Standards” yang dikeluarkan oleh Joint Commision on Accreditation of Health Organizations, Illinois, USA, tahun 2002),yaitu:

1)      Hak pasien

Standarnya adalah:                

Pasien & keluarganya mempunyai hak untuk mendapatkan informasi tentang rencana & hasil pelayanan termasuk kemungkinan terjadinya KTD (Kejadian Tidak Diharapkan).

Kriterianya adalah

  • Harus ada dokter penanggung jawab pelayanan
  • Dokter penanggung jawab pelayanan wajib membuat rencana pelayanan
  • Dokter penanggung jawab pelayanan wajib memberikan penjelasan yang jelas dan benar kepada pasien dan keluarga tentang rencana dan hasil pelayanan, pengobatan atau prosedur untuk pasien termasuk kemungkinan terjadinya KTD
  1. Mendidik pasien dan keluarga

Standarnya adalah RS harus mendidik pasien & keluarganya tentang kewajiban & tanggung jawab pasien dalam asuhan pasien.

Kriterianya adalah:

Keselamatan dalam pemberian pelayanan dapat ditingkatkan dgn keterlibatan pasien    adalah partner dalam proses pelayanan. K   arena itu, di RS harus ada system dan mekanisme mendidik pasien & keluarganya tentang kewajiban & tanggung jawab pasien dalam asuhan pasien.Dengan pendidikan tersebut diharapkan pasien & keluarga dapat:

Memberikan info yg benar, jelas, lengkap dan jujur

  • Mengetahui kewajiban dan tanggung jawab
  • Mengajukan pertanyaan untuk hal yg tdk dimengerti
  • Memahami dan menerima konsekuensi pelayanan
  • Mematuhi instruksi dan menghormati peraturan RS
  • Memperlihatkan sikap menghormati dan tenggang rasa
  • Memenuhi kewajiban finansial yang disepakati
  1.   Keselamatan pasien dan kesinambungan pelayanan

          Standarnya adalah RS menjamin kesinambungan pelayanan dan menjamin koordinasi antar tenaga     dan antar unit pelayanan.

Kriterianya adalah:

  • koordinasi pelayanan secara menyeluruh
  • koordinasi pelayanan disesuaikan kebutuhan pasien dan kelayakan sumber daya
  • koordinasi pelayanan mencakup peningkatan komunikasi
  • komunikasi dan transfer informasi antar profesi kesehatan
  1. Penggunaan metode-metode peningkatan kinerja untuk melakukan evaluasi dan program peningkatan keselamatan pasien

Standarnya adalah RS harus mendesign proses baru atau memperbaiki proses yg ada, memonitor & mengevaluasi kinerja melalui pengumpulan data, menganalisis secara intensif KTD, & melakukan perubahan untuk meningkatkan kinerja serta KP.

Kriterianya adalah

  • Setiap rumah sakit harus melakukan proses perancangan (design) yang baik, sesuai dengan ”Tujuh Langkah Menuju Keselamatan Pasien Rumah Sakit”.
  • Setiap rumah sakit harus melakukan pengumpulan data kinerja
  • Setiap rumah sakit harus melakukan evaluasi intensif
  • Setiap rumah sakit harus menggunakan semua data dan informasi hasil analisis

5.      Peran kepemimpinan dalam meningkatkan keselamatan pasien

Standarnya adalah

  • Pimpinan dorong & jamin implementasi progr KP melalui penerapan “7 Langkah Menuju KP RS ”.
  • Pimpinan menjamin berlangsungnya program proaktif identifikasi risiko KP & program mengurangi KTD.
  • Pimpinan dorong & tumbuhkan komunikasi & koordinasi antar unit & individu berkaitan dengan pengambilan keputusan tentang KP
  • Pimpinan mengalokasikan sumber daya yg adekuat utk mengukur, mengkaji, & meningkatkan kinerja RS serta tingkatkan KP.
  • Pimpinan mengukur & mengkaji efektifitas kontribusinyadalam meningkatkan kinerja RS & KP.

Kriterianya adalah

  • Terdapat tim antar disiplin untuk mengelola program keselamatan pasien.
  • Tersedia program proaktif untuk identifikasi risiko keselamatan dan program meminimalkan insiden,
  • Tersedia mekanisme kerja untuk menjamin bahwa semua komponen dari rumah sakit terintegrasi dan berpartisipasi
  • Tersedia prosedur “cepat-tanggap” terhadap insiden, termasuk asuhan kepada pasien yang terkena musibah, membatasi risiko pada orang lain dan penyampaian informasi yang benar dan jelas untuk keperluan analisis.
  • Tersedia mekanisme pelaporan internal dan eksternal berkaitan dengan insiden,
  • Tersedia mekanisme untuk menangani berbagai jenis insiden
  • Terdapat kolaborasi dan komunikasi terbuka secara sukarela antar unit dan antar pengelola pelayanan
  • Tersedia sumber daya dan sistem informasi yang dibutuhkan
  • Tersedia sasaran terukur, dan pengumpulan informasi menggunakan kriteria objektif untuk mengevaluasi efektivitas perbaikan kinerja rumah sakit dan keselamatan pasien

6.      Mendidik staf tentang keselamatan pasien

Standarnya adalah

  • RS memiliki proses pendidikan, pelatihan & orientasi untuk setiap jabatan mencakup keterkaitan jabatan dengan KP secara jelas.
  • RS menyelenggarakan pendidikan & pelatihan yang berkelanjutan untuk meningkatkan & memelihara kompetensi staf serta mendukung pendekatan interdisiplin dalam pelayanan pasien.

Kriterianya adalah

  • Memiliki program diklat dan orientasi bagi staf baru yang memuat topik keselamatan pasien
  • Mengintegrasikan topik keselamatan pasien dalam setiap kegiatan inservice training dan memberi pedoman yang jelas tentang pelaporan insiden.
  • Menyelenggarakan pelatihan tentang kerjasama kelompok (teamwork) guna mendukung pendekatan interdisiplin dan kolaboratif dalam rangka melayani pasien.

7.      Komunikasi merupakan kunci bagi staf untuk mencapai keselamatan pasien.

Standarnya adalah

  • RS merencanakan & mendesain proses manajemen informasi KP untuk memenuhi kebutuhan informasi internal & eksternal.
  • Transmisi data & informasi harus tepat waktu & akurat.

Kriterianya adalah

  • Disediakan anggaran untuk merencanakan dan mendesain proses manajemen untuk memperoleh data dan informasi tentang hal-hal terkait dengan keselamatan pasien.
  • Tersedia mekanisme identifikasi masalah dan kendala komunikasi untuk merevisi manajemen informasi yang ada.

Perbedaan yang dapat dilihat yakni

1). Kewaspadaan pada universal dianjurkan pada darah dan semua cairan tibuh serta eksresi untuk mencegah penyabaran bakteri seperti penyebaran pathogen melalui darah

  • Kewaspadaan paling utama yakni cuci tangan
  • Hati- hait terhadap objek tajam..gunakan sarung tanag untuk menutup jarum bersih sekalipun
  • Untuk mencegah cedera tusukan, tempatkan spoit , jarum, pisau bedah dan benda tajam dalam wadah tertentu
  • Lindungi diri dari paparan darah atau cairan lain
  • Pegang linen kotor sesering mungkin
  • Gunakan desinfektan untuk mendekontaminasika permukaan kerja bila ada tetesan darah atau cairan lain.
  • Jangan merawat pasien bila anda sedang mengalami lesi kulit.

2). Pada ruang/ lingkup isolasi

Ruangan isolasi biasanya digunkan untuk menempatkan pasien yang mempunyai penyakit yang mudah menyebar pada orang lain.

  • Jangan menghindari pasien yang terisolasi , tetapi rawat seperti pasien lain
  • Siapkan ruangan dengan menyingkirkan peralatan yang tidak perlu
  • Alat makan pasien yang diisolasikan harus dicuci terpisah  dan memiliki toilet terpisah.
  • Tempatkan benda yang terkontaminasi dalam wadah atau kanting berlapis plastic.beri label sebagai barabg infeksius. Bersihkan runagan dengan cairan desinfektan ,. Gunakan alat pembersih sendiri untuk ruangan ini.
  • Setelah kontak dengan pasien , lepaskan sarung tangan anda dan cuci tanagan larutan antiseptic atau sabun dan air.
  • Beri pendidikan tentang cara menjaga kingkungan, xcara membuang sampah.dan beri kesempatan apsien bertanya.
  • Untuk penyakit TBC harus mendapat ventilasi cukup untuk ruanganya. Pintu ke koridor harus senantiasa ditutup utuk mengurangi penyebaran infeksi melalui udara
  • Jengan mengeringkan runagn atau mengibas linen tempat tidur dan pakaian kotor dalam ruanagan.
  • Gunakan masker wajah dan pakain pelindung untuk mengurangi resiko penyevbaran virus pada diri sendiri mauopaun orang lain.
  • Utnuk pasien lepraajarkan tenik perlindungan diri seperti sepatu untuk menlindungi kaki yang tidak sensitive, menggunakan sarung tangan.
  • Ajarkan pasien mencuci tangan dan menggunkan Vaseline dengan teratur untuk mencegah pecah- pecah kulit dan ajarkan rentang gerak
  • Untuk pasien HIV/AIDS dengan menhindari paparan langsung dengan darah, cairan tubuh dan cedera tusukan jarum
  • Gunakan lat sekali pakai dan buang pada wadah yang telah ditentukan
  • Gunakan sarung tangan tebal utnuk menbersihkan alat yang digunakan.
  • Pisahkan linen dan pakain dengan pakaina dank linen lainnya.
  • Cuci tangan sebelum dan sesudah melakukan tindakan, cuci tangan bisa rutin dan sering

 

      Jenis-jenis APD

  1.  Alat pelindung kepala

Fungsi

Alat pelindung kepala adalah alat pelindung yang berfungsi untuk melindungi kepala dari benturan, terantuk, kejatuhan atau terpukul benda tajam atau benda keras yang melayang atau meluncur di udara, terpapar oleh radiasi panas, api, percikan bahan-bahan kimia, jasad renik (mikro organisme) dan suhu yang ekstrim. Jenis alat pelindung kepala terdiri dari helm pengaman (safety helmet ), topiatau tudung kepala, penutup atau pengaman rambut, dan lain-lain.

 

  1. Alat pelindung mata dan muka.

              Fungsi

Alat pelindung mata dan muka adalah alat pelindung yang berfungsi untuk melindungi mata dan muka dari paparan bahan kimia berbahaya, paparan partikel-partikel yang melayang di udara dan di badan air, percikan benda-benda kecil, panas, atau uap panas, radiasi gelombang elektromagnetik yang mengion maupunyang tidak mengion, pancaran cahaya, benturan atau pukulan benda keras ataubenda tajam.

Jenis alat pelindung mata dan muka terdiri dari kacamata pengaman (spectacles),  goggles, tameng muka (face shield ), masker selam, tameng muka dan kacamata pengaman dalam kesatuan (full face masker ).

 

  1.  Alat pelindung telinga.

              Fungsi

Alat pelindung telinga adalah alat pelindung yang berfungsi untuk melindungi alat pendengaran terhadap kebisingan atau tekanan.

Jenis alat pelindung telinga terdiri dari sumbat telinga (ear plug) dan penutup telinga (ear muff).

 

  1.  Alat pelindung pernapasan beserta perlengkapannya.

              Fungsi

Alat pelindung pernapasan beserta perlengkapannya adalah alat pelindung yang berfungsi untuk melindungi organ pernapasan dengan cara menyalurkanudara bersih dan sehat dan/atau menyaring cemaran bahan kimia, mikro-organisme, partikel yang berupa debu, kabut (aerosol), uap, asap, gas/ fume, dansebagainya.b.

Jenis alat pelindung pernapasan dan perlengkapannya terdiri dari masker, respirator, katrit, kanister.

 

  1.  Alat pelindung tangan.

 Fungsi

Pelindung tangan (sarung tangan) adalah alat pelindung yang berfungsi untuk melindungi tangan dan jari-jari tangan dari pajanan api, suhu panas, suhu dingin,radiasi elektromagnetik, radiasi mengion, arus listrik, bahan kimia, benturan,pukulan dan tergores, terinfeksi zat patogen (virus, bakteri) dan jasad renik. Jenis pelindung tangan terdiri dari sarung tangan yang terbuat dari logam, kulit, kain kanvas, kain atau kain berpelapis, karet, dan sarung tangan yang tahan bahan kimia

 

  1.  Alat pelindung kaki.

 Fungsi

Alat pelindung kaki berfungsi untuk melindungi kaki dari tertimpa atau berbenturan dengan benda-benda berat, tertusuk benda tajam, terkena cairan panas atau dingin, uap panas, terpajan suhu yang ekstrim, terkena bahan kimia berbahaya dan jasad renik, tergelincir. Jenis Pelindung kaki berupa sepatu keselamatan pada pekerjaan peleburan, pengecoran logam, industri, kontruksi bangunan, pekerjaan yang berpotensi bahaya peledakan, bahaya listrik, tempat kerja yang basah atau licin, bahan kimia dan jasad renik, dan/atau bahaya binatang dan lain-lain.

 

 

  1.  Pakaian pelindung.

 Fungsi

Pakaian pelindung berfungsi untuk melindungi badan sebagian atau seluruh bagian badan dari bahaya temperatur panas atau dingin yang ekstrim, pajanan apidan benda-benda panas, percikan bahan-bahan kimia, cairan dan logam panas, uap panas, benturan (impact) dengan mesin, peralatan dan bahan, tergores, radiasi, binatang, mikro-organisme patogen dari manusia, binatang, tumbuhan dan lingkungan seperti virus, bakteri dan jamur.

 

      Cuci tangan:

  • Selalu melepas perhiasan sebelum mencuci tangan
  • Menggunakan sabun dan air mengalir
  • Membasahi tangan dan pergelangan tangan , pertahankan tangan lebih rendah dari siku utnuk menghindari kontaminasi
  • Gosok dengan keras hingga berbusa
  • Jika tangan anda kotor , gosok agak lama sekitar 4- 5 jam
  • Bersihkan bagian bawah kuku anda
  • Jika anda menggunakan sabun padat, cuci sabun setelah anda memakainya
  • Keringkan tangan dengan cermatdengan handuk kering
  • Gunakan sudut handuk untuk menutup kran dioperasikan dengan tangan

 

      Konsep Standar Pengendalain Infeksi

Cara  paling mudah mencegah penyebaran infeksi adalah membunuh mikroorganisme ketika mereka ada di tangan, alat dan perabot, seperti, tempat tidur pasien. Cara paling efektif membunuh mikroorganisme adalah:

  1. Antisepsis – > membunuh atau menghentikan pertumbuhan mikroorganisme.
  2. Dekontaminasi – >membuat objek lebih aman dipegang sebelum pembersihan.
  3. Pembersihan -> menghilangkan kotoran dan mikroorganisme dari kulit dan objek, dengan menggunakan sabun dan air.
  4. Disinfeksi kadar tinggi -> membunuh kebanyakan organisme pada objek.
  5. Sterilisasi  -> membunuh semua mikroorganisme pada objek,misalnya peralatan bedah.      

 

 

 

Metode tambahan untuk mencegah infeksi yaitu:        

 

1        Pakaian pelindung

2        Pembuangan yang aman pada limbah tubuh dan benda-benda terinfeksi,misalnya balutan.

Untuk mencegah penyebaran infeksi dirumah sakit,perawat dan pemberi perawatan kesehatan yang lain mengikuti praktik medis dan asepsis bedah.

–          Teknik bersih ( asepsis medis ) mengurangi jumlah mikroorganisme yang ada dan mencegahnya masuk ke pasien.

–          Teknik pembedahan ( asepsis bedah ) mencakup mempertahankan objek dan area bebas mikroorganisme untuk meyakinkan bahwa prosedur pembedahan steril.

 

 Adapun teknik bersih yang bisa dijadikan pedoman untuk pengendalian infeksi.

 

       Untuk teknik bersih,ikuti pedoman berikut:

 

1        Bersihkan luka dari sisi luka bagian dalam kearah luar. Ganti balutan yang kotor dan buang dengan benar. Gunakan salin normal untuk mencuci luka yang bersih. Gunakan betadine dan chlorexidine untuk membersihkan kulit. Gunakan sabun dan air untuk mencuci luka kotor.

2        Cegah penyebaran mikroorgamisme dalam droplet. Dorong pasien menutup mulut mereka dengan menggunakan tissue atau sapu tanganbila bersin.

3        Jangan pernah mengizinkan pasien menggunakan alat pribadi bersam orang lain. Pertahankan tempat tidur bersih dan kering.tidak boleh ada air dan botol diatasnya.

4        Bersihkan dan desinfektan objek kotor yang akan digunakan ulang

5        Jangan membiarkan linen kotor dan artikel lain menyentuh seragam anda. Buang dengan tepat.

6        Kosongkan pengisap dan botol drainase sebelum botol penuh

7        Jangan menyebarkan debu dengan mengibas linen

8        Jangan menempel alat dan kain dilantai

9        Gunakan sarung tangan bersih bila memengang cairan tubuh.

10    Gunakan pakaian pelindung

11    Ketika membersihkan area kotor , bersihkan dulu area yang tidak kotor.

12    Tunnagkan cairan ke wastafel dekat kran sehingga tidak terciprat

13    Tempat jarum dan spoit kedalam wadah khusus

14    Cuci tangan dengan sering.                                

 

Selain itu perawatan alat juga perlu diperhatikan.

 

 Adapaun teknik perawatan alat yakni:

–          Sebelum mencuci alat bedah yang digunakan jarum dan spuit yang dapat dipakai lang, dan sarung tangan harus didekonrtaminasikan . dekontaminasi dengan larutan pemutih klorin 0,5% untuk dekontaminasi virus HIV/AIDS dan hepatitis B.

–          Ketika anda mencuci objek kotor , pertama kali cuci dengan air dingin muntuk melepas material organic seperti mucus dan darah. Setelah itu cuci dengan air panas, jika perlu gunakan sikat membersihkannya

–          Untuk medesinfeksi objek , gunakan preparat kimia, seperti fenol atau senyawa iodine.

Sterilisasi dapat digunakan dengan pemanasan atau air mendidih

Posted on by azwarajuar | Leave a comment

A.                BIOAKUSTIK

v    DEFENISI

  • Akustik membahas segala hal yang berhubungan dengan bunyi. Bioakustik membahas bunyi yang berhubungan dengan makhluk hidup, terutama manusia.
  • Bioakustik adalah bidang ilmu yang mempelajari karakteristik suara, organ suara, fungsi suara, fisiologi suara, analisis suara dan manfaat suara pada makhluk hidup.
  • Bahasan bioakustik: proses pendengaran dan instrumen bunyi
  • Membahas bio-akustik berarti berusaha mengurai keterkaitan antara bunyi – gelombang bunyi, getaran dan sumber bunyi dengan kesehatan.
  • Bunyi atau suara adalah kompresi mekanikal atau gelombang longitudinal yang merambat melalui medium, medium atau zat perantara ini dapat berupa zat cair, padat, gas.
  • Gelombang bunyi timbul akibat terjadi perubahan mekanik pada gas, zat cair atau gas yang merambat dengan kecepatan tertentu.

 

v    Bagian- Bagian Yang Berhubungan Dengan Bioakustik

  1. 1.                  Bunyi
  • Bunyi merupakan gelombang longitudinal.
  • Fenomena bunyi berhubungan dengan indera pendengaran kita, yaitu telinga kita         dan otak kita.
  • Telinga berfungsi menerima gelombang bunyi, sedangkan otak berfungsi menerjemahkan informasi dari telinga.
  • Sifat-sifat gelombang bunyi:
  1. Gelombang bunyi memerlukan medium dalam perambatannya
  2. Mengalami pemantulan (refleksi)
  3. Mengalami pembiasan (refraksi)
  4. Mengalami pelenturan (difraksi)
  5. Mengalami perpaduan (interferensi)
  6. Mengalami penguraian (dispersi)
  7. Dapat diserap arah getarnya (polarisasi)
    1.  Pemantulan (Refleksi)

Contohnya gelombang cahaya dipantulkan oleh cermin. Pada pemantulan berlaku hokum tentangpemantulan
• Sudut datang sudut pantul dan garis normal berada pada satu bidang
•    Sudut datang sama dengan sudut pantul.

  1. Pembiasaan ( refraksi )

Contohnya pembiasan pada air, lensa. Pembiasan adalah peristiwa gelombang yang mengalami pembelokan arah karena melewati dua medium yang berbeda. Pada pembiasaan berlaku hokum sneliuas tentang pembiasaan.
• Sudut datang sudut pantul dan garis normal berada pada satu bidang
•    Sudut datang sama dengan sudut pantul memiliki hubungan

  1.  penggabungan ( interferensi )

Peristiwa interferensi dapat diamati pada terlihatnya warna-warni pada permukaan air sabun, warna warninya permukaan CD. Peristiwa interferensi terjadi karena perpaduan dua buah gelombang yang memiliki frekwensi dan beda fase yang sama, saling bertemu.

  1.  lenturan ( defraksi )
  • Peristiwa defraksi dapat dialami ketika kita mendengar suara yang berasal dari balik tembok, atau bukit. Meskipun tidak ada benda yang memantulkan suara itu disekitar kita.
  • Peristiwa defraksi terjadi karena gelombang melenturkan energinya . Perhatikan contoh defraksi pada gelombang air yang melewati celah sempit. 

 

  1. Dispersi ( penguraian )

  Peristiwa dispersi dapat diamati pada terurainya gelombang cahaya polikromatik menjadi komponen gelombang cahaya yang monokromatik ketika melewati prisma.
Peristiwa disperse terjadi karena gelombang mengalami perubahan bentuk ketika melewati suatu medium yang dispersif (medium yang dapat merubah kecepatan yang tergantung frekwensinya)

  1. polarisasi

Peristiwa polarisasi dapat dirasakan pada saat menggunkan kacamata Polaroid kita tidak mengalami silau saat berjemur di terik matahari. Peristiwa Polarisasi terjadi karena gelombang trasversal mengalami penyerapan arah getarnya. Peristiwa Polarisasi hanya terjadi trasversal saja. Perhatikan gambar berikut. Gelombang utuh yang tidak terpolarisasi melalui filter yang akan meneruskan arah getas sesui orientasi filter tersebut.

 

  • polarisasi dapat terjadi karena:

a.Pemantulan
b.Pembiasan
c.Absorpsi  
d.Bias
e.Hamburan

  1. effek dopler

Peristiwa ini dapat diamati ketika kita mendengarkan suara ambulan yang mendekati atau menjauhi kita., yang terdengar makin keras saat mendekati kita dan makin lemah saat menjauhi kita.

Peristiwa Effek Dopler adalah peristiwa berubahnya frekwensi gelombang akibat gerak relative antara sumber gelombang dengan pengamat.

Penerapan

        Dari  sifat – sifat bunyi:

          1. Dua astronout tidak dapat bercakap-cakap langsung tetapi menggunakan alat komunikasi seperti telepon karena keadaan dalam pesawat dibuat hampa udara.
2. Terjadinya gaung, yaitu sebagian bunyi pantul bersamaan dengan bunyi asli sehingga bunyi asli terdengar tidak jelas.
3. Pada malam hari bunyi petir terdengar lebih keras daripada siang hari.
4. Kita dapat mendengar bunyi ditikungan meskipun kita belum melihat mobil tersebut    karena terhalang tembok yang tinggi.

            Udara adalah pengantar bunyi yang paling banyak kita gunakan. Namun sebenarnya udara pengantar bunyi yang lamban, bukan berarti tidak baik. Kecepatan merambat bagi udara sebagai pengantar bunyi hanyalah 340 meter per detik. Bandingkan dengan kecepatan rambat bunyi pada zat pengantar lain :

Gabus…………………………………500 meter per detik
Timah…………………………………1190 meter per detik
Air……………………………………..1440 meter per detik
Besi……………………………………5120 meter per detik

Angka-angka tersebut memang dapat berubah oleh perubahan suhu.

 

            Aspek Bunyi

  • Tiga aspek bunyi: sumber bunyi, energi bunyi, dan detektor bunyi.
  • Sumber bunyi adalah semua benda yang bergetar.
    • Energi bunyi dipindahkan dari sumber bunyi dalam bentuk gelombang bunyi, yaitu gelombang longitudinal.
    • Detektor bunyi adalah alat untuk menangkap/menerima gelombang bunyi, bisa berupa telinga kita atau alat lain.

           Karakteristik Bunyi

  • Gelombang bunyi merambat memerlukan medium.
  • Medium perambatan bunyi bisa berupa udara, tanah, batu, logam, dan lain-lain.
  • Bunyi tidak dapat merambat di dalam ruang hampa udara

        Jenis Gelombang Berdasarkan Medium Perambatan

  • gelombang mekanik
  • gelombang yang berjalan di dalam suatu material yang dinamakan medium
  • gelombang elektromagnetik
  • gelombang yang tidak memerlukan medium dalam perambatannya

         Jenis Gelombang Berdasarkan Arah Rambat

  • gelombang transversal

gelombang yang arah pergeseran mediumnya tegak lurus dengan arah perjalanan gelombang sepanjang medium itu.

  • gelombang longitudinal

gelombang yang arah pergeseran mediumnya searah dengan arah perjalanan gelombang sepanjang medium itu

            Panjang gelombang adalah sebuah jarak antara satuan berulang dari sebuah pola   gelombang.  Biasanya memiliki denotasi hurufYunanilambda (λ).

•   Jarak dari satu puncak ke puncak berikutnya atau dari satu lembah ke lembah berikutnya, atau dari sembarang titik ke titik yang bersangkutan pada pengulangan berikutnya dari gelombang tersebut

         Frekuensi   

             •      Frekuensi suara adalah tingkat di mana gelombang melewati suatu titik tertentu.

             •      banyaknya gelombang dalam selang waktu tertentu

             •      Jumlah gelombang tiap detik

             •      Lambang frekuensi (f)

           Pembagian frekuensi bunyi:

•      0-20 Hz  : daerah infrasonik, yang termasuk disini adalah getaran tanah, gempa bumi.

•      20-20.000 Hz     : daerah sonik, yaitu daerah frekuensi yang dapat didengar/ Tertangkap oleh indera pendengar manusia, misalnya suara pembicaraan, suara lonceng dan sebagainya (audiofrekuensi).

•      Di atas 20.000 Hz: daerah ultrasonik. Tak tertangkap oleh indera pendengar manusia, misalnya getaran yang dihasilkan oleh magnet listrik, getaran kristal piezo elektrik yang digunakan beberapa instrumen kedokteran (USG dll).

          Kecepatan bunyi di udara adalah 340 m/s.

          Jika sesuatu memiliki kecepatan melampaui kecepatan suara di udara ini, disebut sebagai        supersonik.

         Contohnya adalah pesawat supersonik dengan kecepatan 2000 kilometer perjam.

        •      Frekuensi bunyi berubah akibat perubahan jarak sumber bunyi-pendengar

   Cepat Rambat Gelombang adalah:

Hubungan antara panjang gelombang (l) dan frekuensi gelombang (f) dengan       cepat rambat gelombang (v)  – >      v = lf

             velocity = wavelength x frequency

       •  Laju gelombang dipengaruhi oleh sifat-sifat mekanik medium perambatannya

       •  Gelombang bunyi timbul akibat terjadi perubahan mekanik  pada gas, zat cair atau padat yang merambat  dengan kecepatan tertentu.

       •  Menjalar secara transversal atau longitudinal. Bunyi mempunyai hubungan antara frekuensi (f), panjang gelombang (λ) dan kecepatan V. – >   V = l.f  

V = kecepatan perambatan bunyi dalam meter per sekon (m/s)

l = panjang gelombang dalam meter (m)

f = frekuensi dalam Hertz (Hz)

       Intensitas Bunyi

  • Intensitas bunyi adalah energi yang dibawa oleh sebuah gelombang bunyi melalui satuan luas tiap satuan waktu.
  • Energi gelombang bunyi ada 2 yaitu : energi potensial dan energi kinetic. Intensitas gelombang bunyi(I ) yaitu energi yang melewati medium 1 m2/detik atau watt/m2
  • Satuan intensitas bunyi adalah  watt/meter2  (W/m2)
  • Telinga manusia dapat mendeteksi bunyi dengan intesitas (I)

        Jenis-Jenis Bunyi Bising

         * `Steady Wide Band Noise’

            – Meliputi bunyi dengan batas ulangan yang luas

            – Contoh : Mesin biasa, Keriuhan Di Pasar, Trafik.

         * `Steady Narrow Band Noise’

            – Tenaga bunyi tertumpu kepada ulangan tertentu.

            – Contoh : Mesin Rumput, Gergaji Rantai, Pengetam.

         * `Impact Noise’

            – Bunyi tunggal yang pendek.

            – Contoh : Letupan, Tembakan senjata api.

         * `Repeated Impact Noise’

            – Bunyi tunggal yang berulangan.

            – Contoh : Memaku, Memahat.

         * `Intermittent Noise’

            – Contoh : Pengangkutan Udara, Lalulintas.

        Kesan Bunyi Bising Terhadap Kesehatan Terbagi  dua :          

  • Kesan Kepada Telinga

            a) Kesan Semerta

               – Disebabkan bunyi yang kuat (>120 dB)

               – Menyebabkan pecah selaput tympanum,  kerusakan tulang kecil pendengaran.

               – Hilang pendengaran kekal.

            b) Kesan Kronik

               – Pendedahan berpanjangan kepada bunyi kuat (>85 dB – 5 tahun, > 8 jam sehari)

               – Lebih tinggi frekuensi, kerusakan koklea  tinggi

            c) TTS (Temporary Threshold Shift)

                – Threshold pendengaran tinggi semasa bekerja di tempat bising.

               – Kembali asal setelah 12 jam keluar dari  suasana bising.

            d) PTS(Permanent Threshold Shift)

               – Pendedahan berulangan – threshold   pendengaran tidak kembali kepada ‘base   line’ asal.

            Kesan Di Luar Telinga

            a) Kesan Fisiology

– Meningkatkan Tekanan darah melalui galakan ANS (Autonomy Nervous System)

 

               – Meningkatkan Pergerakan Otot.

               – Meningkatkan pergerakan gastric  pembesaran pupil.

            b) Kesan Psychosomatic.

               – Sakit Kepala, pening, loya, muntah

               – Nystagmus , pergerakan mata tak dapat dikawal.

            c) Kesan Pyscology

– Gangguan Percakapan

– Mutu kerja dan kecekapan menurun.

– Keletihan

– Gangguan saraf dan ketegangan    

            d)  Lain-lain

                – Mudah marah

                – Sering merasa cemas.

          Penerapan Bunyi dalam Kesehatan

           Alat diagnostik USG menggunakan gelombang ultrasonik yang mempunyai   frekuensi 1-10 MHz.

  •    USG(Ultrasonography)
    Ultrasonografi medis (sonografi) adalah sebuah teknik diagnostik pencitraan menggunakan suara ultra yang digunakan untuk mencitrakan organ internal dan otot, ukuran mereka, struktur, dan luka patologi, membuat teknik ini berguna untuk memeriksa organ. Sonografi obstetrik biasa digunakan ketika masa kehamilan.

Untuk diagnostik digunakan frekuensi 1 – 5 MHz dengan daya 0,01 W/cm2.
Untuk terapi daya ditingkatkan menjadi 1 W/cm2, bahkan untuk menghancurkan kanker daya yang diperlukan sebesar 103 W/cm2.
Dasar penggunaan ultrasonik adalah efek Dopler, yaitu terjadi perubahan frekuensi akibat adanya pergerakan pendengar atau sebaliknya dan getaran yang dikirim ke obyek akan direfleksikan oleh obyek itu sendiri.

        Hal -hal yang didiagnosis dengan Ultrasonik:

Sesuai dengan metode skaining yang dipakai maka ultrasonik dapat dipergunakan untuk diagnosis :

        1) A scaning : Mendiagnosis tumor otak, member informasi tentang penyakit –   penyakit mata.

       2) B Scanning :

a. Untuk memperoleh informasi struktur dalam dari tubuh manusia, misalnya hati,   lambung, usus,mata dan jantung janin.

b. Untuk  mendeteksi kehamilan sekitar 6 minggu, kelainan dari uterus/kandung peranakan dan kasus – kasus perdarahan yang abnormal.

c. Lebih banyak memberi informasi dari pada X-ray dan sedikit resiko yang terjadi

            3 ) M scanning

  1. Memberi informasi tentang jantung, valvula jantung, pericardical effusion.
  2. M scaning mempunyai kelebihan yaitu dapat dikerjakan sembari pengobatan berlangsung  untuk menunjukkan kemajuan dalam pengobatan.

 

 

Pembentukan Suara

Suara dihasilkan oleh getaran suatu benda. Selama bergetar, perbedaan tekanan terjadi di udara sekitarnya. Peningkatan tekanan disebut kompresi, sedangkan penurunannya disebut rarefaction. Suara adalah fenomena fisik yang dihasilkan oleh getaran benda, getaran suatu benda yang berupa sinyal analog dengan amplitudo yang berubah secara kontinyu terhadap waktu. Pada hakekatnya suara dan bunyi adalah sama. Hanya saja kata “suara” dipakai untuk makhluk hidup, sedangkan bunyi dipakai untuk benda mati.

 

•      Aliran udara yang dihasilkan dorongan otot paru-paru bersifat konstan. Ketika pita suara dalam keadaan berkontraksi, aliran udara yang lewat membuatnya bergetar.

•      Aliran udara tersebut dipotong-potong oleh gerakan pita suara menjadi sinyal pulsa yang kemudian mengalami modulasi frekuensi ketika melewati pharynx, rongga mulut ataupun pada rongga hidung. Sinyal suara yang dihasilkan pada proses ini dinamakan sinyal voiced sound.

•      Suara bicara normal merupakan hasil dari modulasi udara yang keluar dari dalam tubuh.

•      Beberapa bunyi ayang dihasilkan melalui mulut tanpa menggunakan pita suara disebut Unvoiced sound, merupakan aliran udara melalui penciutan/konstriksi yang dibentuk oleh lidah, gigi, bibir dan langit-langit. Misalnya p, t, k, s, dan ch, secara perinci:

•      p, t, dan k suara/bunyi letupan (plosive sound)

•      S, f, dan ch suara/bunyi frikatif (fricative sound)

 

Proses produksi suara pada manusia dapat dibagi menjadi tiga buah proses fisiologis, yaitu :

•      pembentukan aliran udara dari paru-paru,

•      perubahan aliran udara dari paru-paru menjadi suara, baik voiced, maupun unvoiced yang dikenal dengan istilah phonation,

•      dan artikulasi yaitu proses modulasi/ pengaturan suara menjadi bunyi yang spesifik.

•      Organ tubuh yang terlibat pada proses produksi suara adalah : paru-paru, tenggorokan (trachea), laring (larynx), faring (pharynx), pita suara (vocal cord), rongga mulut (oral cavity), rongga hidung (nasal cavity), lidah (tongue), dan bibir (lips).

 

PEMBENTUKAN  SUARA (FONASI)

•      Pada pembentukan suara vokal, pita suara tertarik saling mendekat oleh otot, udara di paru dihembuskan, tekanan dibawah pita suara meningkat dan pita suara yang tertutup dipaksa membuka.

•      Terjadi aliran cepat udara ke atas yang menyebabkan penurunan tekanan di antara pita, menyebabkan pita suara bergerak bersama, menghambat keluarnya udara secara parsial.

•      Rongga mulut berubah bentuk akibat garakan lidah, rahang bawah, palatum lunak, dan pipi untuk menentukan suara yang diucapkan.

•      Kadang-kadang hilangnya suara, gangguan bicara, atau rasa sakit timbul akibat obstruksi di pita suara.

•      Hal tersebut perlu dilakukan pemeriksaan, salah satu metode yang digunakan adalah laringoskopi.

•      Metode lain juga yang digunakan adalah MRI, USG, dan berbagai prosedur radiologis misalnya sinar-X, CT-scan, dan sebagainya.

 

Frekuensi dasar dari hasil vibrasi yang kompleks tergantung dari massa dan tegangan dari pita suara.

•      Laki-laki mempunyai frekuensi suara 125 Hz.

•      Wanita  mempunyai frekuansi suara 250 Hz.

•      Suara berhubungan erat dengan rasa “mendengar”.

 

Pada sistem pengenalan suara oleh manusia terdapat tiga organ penting yang saling berhubungan yaitu :

•      telinga yang berperan sebagai transduser dengan menerima sinyal masukan suara dan mengubahnya menjadi sinyal syaraf,

•       jaringan syaraf yang berfungsi mentransmisikan sinyal ke otak,

•      dan otak yang akan mengklasifikasi dan mengidentifikasi informasi yang terkandung dalam sinyal masukan.

 

Fisika Pendengaran

 

Mendengar adalah kemampuan untuk mendeteksi vibrasi mekanis (getaran) yang kita sebut suara.

•      Dalam keadaan biasa, getaran mencapai indera pendengar yaitu telinga.

•      Bunyi merupakan vibrasi (getaran) di uadara yg hanya dpt di dengar oleh telinga manusia antara 20 – 20.000 hertz.

•      Telinga manusia terdiri atas tiga bagian, yaitu telinga luar, telinga tengah dan telinga bagian dalam.

Anatomi Telinga

 

 

 

 

 

a. Telinga Luar

•      Merupakan bagian telinga yang berguna sebagai penangkap getaran suara.

•      Telinga luar terdiri dari daun telinga, lubang  telinga dan saluran telinga luar.

b. Telinga Tengah

•      Bagian ini terdiri dari selaput pendengaran, tulang – tulang pendengaran dan saluran Eustachius.

c. Telinga Dalam

•      Bagian ini terdiri dari tingkap jorong dan rumah siput.

•      Di dalam rumah siput terdapat cairan yang akan bergetar bila ada bunyi.

 

a.      Telinga luar (outer ear)

         DAUN  TELINGA (Pinna auricularis, tunggal = Pinnae auriculares, jamak) berfungsi menangkap & mengarahkan gelombang suara,

         Lorong (Liang) Telinga (Eksternal Auditory Meatus) yg mengandung rambut halus & kelenjar lilin (minyak = sebaseus),

         GENDANG TELINGA (membran tympani), Terdiri dari jaringan fibrosa elastis,Bentuk bundar dan cekung dari luar, Berfungsimenerimagetaransuaradanmeneruskannyapadatulangpendengaran.

 

 

b.      Telinga tengah (middle ear)

         TULANG PENDENGARAN à MIS (Maleus, Inkus, Stapes) MArtil, LAndasan, Sanggurdi.

         Merupaka tulang terkecil pada tubuh manusia, Berfungsi meneruskan amplitudo getaran yang diterima dari membran tympani dan meneruskannya ke jendela oval.

 

 

 

 

 

c. Telinga dalam (inner ear)

•      Terdiri atas

–     Vestibulum

–     kanalis semisirkularis tulang (keseimbangan )

–     Koklea (rumah siput)

–     begitu juga kranial VIII (nervus koklea vestibularis)

•      terjadi aktivitas elektris yang berjalan sepanjang cabang vesti-bular nervus kranialis VIII ke otak.

Cara Kerja Telinga

•      Getaran bunyi terkumpul di daun telinga.

•      Getaran bunyi tersebut kemudian masuk ke dalam lubang telinga.

•      Bila getaranbunyi tersebut mencapai gendang telinga maka gendang tersebut ikut bergetar dan menggetarkan tulang- tulang pendengaran demikan pula cairan di rumah siput ikut bergetar.

•      Gerakan ini mengubah energi mekanik tersebut menjadi energi elektrik ke saraf pendengaran (auditory nerve,) dan menuju  ke pusat pendengaran di otak.

•      Pusat ini akan menerjemahkan energi tersebut menjadi suara yang dapat dikenal oleh otak.

 

Proses Pendengaran Manusia

 

•      Proses pendengaran manusia Pertama di mulai dari daun telinga (outer Ear) yang fungsinya menangkap suara-suara di sekitar dan memasukkan nya ke canal/ lubang telinga.

•      Proses kedua suara yang masuk melalui lubang telinga di terima oleh gendang telinga yang berakibat bergetarnya tiga tulang pendengaran yaitu maleus,inkus dan stapes(middle Ear). Dan menyalurkan ke cohlea / rumah siput.

•      Proses ke tiga di dalam cohlea / Rumah siput  terdapat hear sell yang yang bergetar akibat suara dan getarannya menghasilkan getaran listrik yang dihasilkan dari energy kinestetik. Sehingga aliran listrik itu menjadikan sinyal yang menyalurkan ke otak, yang di aliri oleh syaraf pendengaran, untuk selanjutnya otak yang bekerja mengartikan semua suara-suara yang masuk tadi.  

•      Gangguan pendengaran bisa terjadi pada siapa saja dan pada semua umur , bisa sementara dan bahkan permanen.

•      Gangguan pendengaran disebabkan karena salah satu atau lebih, bagian dari telinga tidak dapat berfungsi secara normal.

Jenis Gangguan Pendengaran

•      Gangguan pendengaran Konduktif : terjadi ketika gelombang suara, terhalang masuknya dari lubang telinga dan gendang telinga menuju ke rumah siput ( koklea ) dan Saraf Pendengaran(Auditory Nerve).

•      Gangguan pendengaran Sensorineural/Saraf : terjadi ketika rumah siput ( koklea) atau saraf pendengaran fungsinya menurun . 

•      Gangguan pendengaran campuran : campuran antara gangguan pendengaran konduktif dan saraf.

 

Pemeriksaan

1. Otoscopy

Pemeriksaan dengan menggunakan alat semacam teropong ini tergolong pemeriksaan awal. Fungsinya untuk melihat liang telinga, apakah ada infeksi atau kotoran telinga.

2. Tympanometry

Pemeriksaan lanjutan ini bertujuan untuk mengetahui fungsi telinga tengah.

 

 

 

 

 

 

 

 

3. Oto Acoustic Emissions (OAE)

Pemeriksaan ini dilakukan untuk mengetahui fungsi sel rambut pada cochlea/rumah siput. Hasilnya dapat dikategorikan menjadi dua, yakni pass dan refer. Pass berarti tidak ada masalah, sedangkan refer artinya ada gangguan pendengaran hingga harus dilakukan pemeriksaan berikut.

 

4. Auditory Brainstem Response (ABR)
Cara pemeriksaannya hampir sama dengan OAE. berfungsi sebagai screening, juga dengan 2 kategori, yakni pass dan refer. Hanya saja alat ini cuma mampu mendeteksi ambang suara hingga 40 dB.

 

5. Conditioned Oriented Responses (CORs)
Pemeriksaan ini dapat dilakukan pada bayi usia 9 bulan sampai 2,5 tahun untuk mengetahui perkiraan ambang dengar anak. Caranya, gunakan alat yang dapat mengeluarkan bunyi-bunyian dan biarkan anak mencari sumber bunyi tersebut.

 

6. Visual Reinforced Audiometry (VRA)
Pemeriksaan yang hampir sama dengan CORs ini juga berfungsi untuk mengetahui ambang dengar anak. Tergolong pemeriksaan subjektif karena membutuhkan respons anak. Namun pada tes ini selain diberikan bunyi-bunyi, alat yang digunakan juga harus dapat menghasilkan gambar sebagai reward bila anak berhasil memberi jawaban. Pemeriksaan ini dapat dilakukan sambil bermain.

 

7. Play Audiometry
Pemeriksaan yang juga berfungsi mengetahui ambang dengar anak ini dapat dilakukan pada anak usia 2,5-4 tahun. Caranya? Menggunakan audiometer yang menghasilkan bunyi dengan frekuensi dan intensitas berbeda. Bila anak mendengar bunyi itu berarti sebagai pertanda anak mulai bermain misalnya harus memasukkan benda ke kotak di hadapannya atau bermain pasel.

 

8. Conventional Audiometry
Pemeriksaan ini dapat dilakukan anak usia 4 tahun sampai remaja. Fungsinya untuk mengetahui ambang dengar anak. Caranya dengan menggunakan alat audiometer yang mampu mengeluarkan beragam suara, masing-masing dengan intensitas dan frekuensi yang berbeda-beda. Tugas si anak adalah menekan tombol atau mengangkat tangan bila mendengar suara.

 

9. Brainstem Evoked Response Audiometry (BERA)
Pemeriksaan ini dapat dilakukan pada semua usia. Fungsinya, untuk mengetahui respons ambang dengar seseorang. Pemeriksaan yang tergolong objektif ini mengharuskan anak dalam keadaan tidur, hingga anak harus dikondisikan tidur lebih dulu.

 

 

Spesialisasi Dalam Pendengaran/Telinga

Didalam bidang kedokteran dibagi dalam masing – masing bagian sesuai dengan keahlian:

  1. Otologist : seorang dokter yang ahli dalam bidang telinga dan pendengaran.
    1. Otolaryngologist : seorang dokter yang ahli dalam bidang penyakit telinga  dan opersi Telinga.
    2.  ENT specialist : dokter ahli THT yaitu seorang dokter yang ahli dalam hal telinga, Hidung dan tenggorokan.
    3.  Audiologist : Seseorang yang bukan dokter, tetapi ahli dalam mengukur respon Pendengaran, diagnosis kelainan pendengaran melalui test pendengaran, Rehabilitasi yang berkaitan dengan hilangnya pendengar.
    4. B.     BIOOPTIK

 

DEFENISI

Menilik kata biooptik, tersusun atas kata bio dan optik. Bio berkaitan dengan makhluk hidup/ zat hidup atau bagian tertentu dari makhluk hidup, sedangkan optik dikenal sebagai bagian ilmu fisika yang berkaitan dengan cahaya atau berkas sinar. secara spesifik ada klasifikasi Optik geometri dan optika fisis. Fokus utama di biooptik adalah terkait dengan indera penglihatan manusia, yaitu mata

Mata menjadi alat optik yang paling penting pada manusia atau makhluk hidup. Bagaimana proses sebuah objek dapat dilihat dan dipersepsikan di otak? Apa saja bagian-bagian mata yang berperan? Mengapa seseorang bisa rabun, atau Mengapa respon mata terhadap perubahan intensitas cahaya di gelap atau terang berbeda? Apa itu rod dan kone? Apa saja jenis kelainan mata dan bagaimana cara mengoreksi atau memperbaikinya?

 

Jenis- Jenis : Optika Geometri dan Optika Fisik

  1. Optika Geometri

Berpangkal pada perjalanan cahaya dalam medium secara garis lurus, berkas-berkas cahaya di sebut garis cahaya dan gambar secara garis lurus. Dengan cara pendekatan ini dapatlah melukiskan ciri-ciri cermin dan lensa dalam bentuk matematika. Misalnya untuk rumus cermin dan lensa :

 =  1  +  1

f        b      v

 

f = focus = titik api

b = jarak benda

v = jarak bayangan

 

Hukum Willebrord Snelius (1581 -1626) :

Sin i  =  n

Sin r

n = indeks bias

i = sudut datang

r = sudut bias (refraksi)

 

  1. Optika Fisik

Gejala cahaya seperti dispersi, interferensi dan polasisasi tidak dapat di jelaskan malui metode optika geometri. Gejala-gejala ini hanya dapat dijelaskan dengan menghitung ciri-ciri fisik dari cahaya tersebut. Sir Isaac Newton (1642-1727), cahaya itu menggambarkan peristiwa cahaya sebagai sebuah aliran dari butir-butir kecil (teori korpuskuler). Sedangkan dengan menggunakan teori kwantum yang dipelopori Plank (1858-1947), cahaya itu terdiri atas kwanta atau foton-foton, tampaknya agak mirip dengan teori Newton yang lama itu. Dengan menggunakan teori Max Plank dapat menjelaskan mengapa benda itu panas apabila terkena sinar.

Thomas Young (1773-1829) dan August Fresnel (1788-1827), dapat menjelaskan bahwa cahaya dapat melentur berinterferensi. James Clark Mexwell (1831-1879) berkebangsaan Skotlandia, dari hasil percobaannya dapat menjelaskan bahwa cepat rambat cahaya (3 X 10 m/detik) sehingga berkesimpulan bahwa cahaya adalah gelombang elektromagnetik.

Huygens ( 1690) menganggap cahaya itu sebagai gejala gelombang dari sebuah sumber cahaya menjalarkan getaran-getaran ke semua jurusan. Setiap titik dari ruangan yang bergetar olehnya dapat dianggap sebagai sebuah pusat gelombang baru. Inilah prinsip dari Huygens yang belum bisa menjelaskan perjalanan cahaya dari satu medium ke medium lainnya. Dari hasil percobaan Einstein (1879-1955) dimana logam di sinari dengan cahaya akan memancarkan electron (gejala foto listrik). Hal ini dapat disimpulkan bahwa cahaya memiliki sifat fartikel dan gelombang magnetic.

Dari uraian di atas dapat disimpulkan bahwa cahaya mempunyai sifat materi (partikel) dan sifat gelombang.

 

  1. HUBUNGAN ANTARA INDEKS BIAS DAN KECEPATAN RAMBAT

Indeks bias dari suatu benda didefinisikan sebagai :

nA  =  sin i

           sin r

i = sudut datang

r = sudut bias

Ini dapat pula didefinisikan sebagai berikut : kecepatan rambat cahaya dalam ruang hampa dibandingkan dengan kecepatan rambat cahaya dalam medium. Dengan demikian bila cepat rambat cahaya di dalam ruang hampa C dan di dalam medium C maka :

                

nA  = C

          CA

 

  1. Macam-macam Bentuk Lensa

Berdasarkan bentuk permukaannya, lensa dibagi menjadi dua, yaitu:

  1. Lensa yang mempunyai permukaan sferis, dibagi menjadi dua macam pula, yaitu:
    1. Lensa Cembung/ Konvergen/ Positif

Sebuah lensa positif atau lensa pengumpul adalah lensa yang bagian tengahnya lebih tebal dari bagian tepinya. Cahaya sejajar yang datang pada sebuah lensa positif difokuskan pada titik focus kedua yang berada pada sisi transmisi lensa tersebut.

  1. Lensa Cekung/ Divergen/ Negatif

Sebuah lensa negative atau lensa menyebar adalah lensa yang bagian tepinya lebih tebal daripada bagian tengahnya. Cahaya sejajar yang datang pada sebuah lensa negative memancar seolah-olah dari titik focus kedua, yang berada pada sisi datang lensa.

  1. Lensa yang mempunyai permukaan silindris

Adalah lensa yang mempunyai silinder, lensa ini mempunyai fokus yang positif dan ada pula yang mempunyai panjang fokus negatif.

           

  1.  Kekuatan Lensa (Dioptri)

Kekuatan lensa dinyatakan dengan satuan dioptri (m-1). Kekuatan lensa (P) sama dengan kebalikan panjang fokusnya (1/f). Jika panjang fokus dalam meter, kekuatan lensa adalah dalam dioptri (D):

                       P = 1 / f(m) = 100 / f (cm)

 

  1. Kesesatan Lensa

Berdasarkan persamaan yang berkaitan dengan jarak benda, jarak bayangan , jarak focus, radius kelengkungan lensa seerta sinar-sinar yang dating paraksial akan kemungkinan adanya kesesatan lensa (aberasi lensa). Aberasi ini ada bermacam-macam :

  1. Aberasi sferis ( disebabkan oleh kecembungan lensa).Sinar-sinar paraksial / sinar-sinar dari pinggir lensa membentuk bayangan di P’. aberasi ini dapat dihilangkan dengan mempergunakan diafragma yang diletakkan di depan lensa atau dengan lensa gabungan aplanatis yang terdiri dari dua lensa yang jenis kacanya berlainan.

Aberasi sferis dapat dikurangi dengan memperkecil ukuran permukaan melengkungnya, yang juga berarti memperkecil jumlah cahaya yang mencapai bayangannya. Aberasi seperti ini namun lebih rumit disebut coma (comet-shapet image) dan  astigmatisma yang terjadi saat obyek-obyek berada di luar sumbu utama. Aberasi dalam bentuk bayagan obyek yang memanjang yang disebabkan kenyataan bahwa perbesaran bergantung pada jarak titik obyek dari sumbu utama disebut distorsi.

Aberasi sferis merupakan hasil dari kenyataan bahwa permukaan melengkung hanya memfokuskan sinar-sinar paraksial (sinar-sinar yang berjalan dekat sumbu utama) pada sebuah titik tunggal. Sinar-sinar non paraksial pada titik dekat yang bergantung pada sudut yang dibuat dengan sumbu utamanya. Sinar-sinar yang mengenai lensa jauh dari sumbu utamadibelokkan lebihh dari sinar-sinar yang dekat dengan sumbu utama, dengan hasilnya bahwa tidak semua sinar difokuskan pada sebuah titik tunggal. Sebaliknya bayangan tersebut kelihatan sebagai sebuah cakram melingkar. Lingkaran dengan kekacauan paling sedikit berada pada titik, di mana garis tengahnya minimum.

 

 

  1. Koma,  Aberasi ini terjadi akibat tidak sanggupnya lensa membentuk bayangan dari sinar di tengah-tengah dan sinar tepi. Berbeda dengan aberasi sferis pada aberasi koma sebuah titik benda akan terbentuk bayangan seperti bintang berekor, gejala koma ini tidak dapat diperbaiki dengan diafragma.
  2. Astigmatisma, Merupakan suatu sesatan lensa yang disebabkan oleh titik benda membentuk sudut besar dengan sumbu sehingga bayangan yang terbentuk ada dua yaitu primer dan sekunder. Apabila sudut antara sumbu dengan titik benda relatif kecil maka kemungkinan besar akan berbentuk koma.
  3. Kelengkungan medan,  Bayangan yang dibentuk oleh lensa pada layer letaknya tidak dalam satu bidang datar melainkan pada bidang lengkung. Peristiwa ini disebut lengkungan medan atau lengkungan bidang bayangan.
  4. Distorsi,  Distorsi atau gejala terbentuknya bayangan palsu. Terjadinya bayangan palsu ini oleh karena di depan atau di belakang lensa diletakkan diafragma atau cela. Benda berbentuk kisi akan tampak bayangan berbentuk tong atau berbentuk bantal. Gejala distorsi ini dapat dihilangkan dengan memasang sebuah cela di antara dua buah lensa.
  5. Aberasi kromatis, Prinsip dasar terjadinya aberasi kromatis oleh karena focus lensa berbeda-beda untuk tiap-tiap warna. Akibatnya bayangan yang terbentuk akan tampak berbagai jarak dari lensa.
  1. Aberasi kromatik dan aberasi lainnya dapat diperbaiki sebagian dengan menggunakan kombinasi beberapa lensa sebagai ganti sebuah lensa tunggal. Sebagai contoh, sebuah lensa positif dan sebuah lensa negative dengan panjang fokus lebih besar dapat digunakan bersama-sama untuk menghasilkan sebuah sistem lensa pengumpul yang mempunyai aberasi kromatik jauh lebih sedikit dibandingkan sebuah lensa tunggal dengan panjang fokus yang sama. Lensa-lensa kamera yang bagus biasanya berisi elemen-elemen untuk memperbaiki berbagai aberasi yang muncul.

 

  1. Mata

Mata merupakan alat optik yang paling dekat dengan kita dan merupakan sistem optik yang paling penting. Dengan mata, kita bisa melihat keindahan alam sekitar kita.

Bagian-bagian Mata

Mata memiliki bagian-bagian yang memiliki fungsi-fungsi tertentu sebagai alat optik, yaitu:

  1. Kornea, merupakan selaput kuat yang tembus cahaya dan berfungsi sebagai pelindung bagian dalam bola mata. Kornea memiliki inervasi saraf tetapi avaskuler (tidak memiliki suplai darah).
  2. Iris, merupakan selaput berbentuk lingkaran yang menyebabkan mata dapat membedakan warna.  Iris adalah diafragma yang melingkar dan berpigmen dengan lubang yang agak di tengah yakni pupil. Iris terletak sebagian dibagian depan lensa dan sebagian di depan badan siliaris. Iris terdiri dari serat otot polos. Fungsi iris yakni mengendalikan jumlah cahaya yang masuk.
  3. Pupil, merupakan celah lingkaran pada mata yang dibentuk oleh iris, berfungsi mengatur banyaknya cahaya yang masuk ke mata.
  4. Lensa mata, merupakan lensa cembung yang terbuat dari bahan bening, berserat dan kenyal, berfungsi mengatur pembiasan cahaya.
  5. Retina, merupakan lapisan yang berisi ujung-ujung saraf yang sangat peka terhadap cahaya. Retina berfungsi untuk menangkap bayangan yang dibentuk oleh lensa mata. Retina merupakan bagian saraf  pada mata, tersusun oleh sel saraf dan serat-seratnya. Retina berperan sebagai reseptor rangsang cahaya. Retina tersusun dari sel kerucut yang bertanggung jawab untuk penglihatan warna dan sel batang yang bertanggung jawab untuk penglihatan di tempat gelap.
  6. Aquaeuos humor, merupakan cairan mata.
  7. Saraf optic, merupakan saraf yang menyampaikan informasi tentang kuat cahaya dan warna ke otak.

Banyak pengetahuan yang kita peroleh melalui suatu penglihatan. Untuk membedakan gelap atau terang tergantung atas penglihatan seseorang. Ada tiga komponen pada penginderaan penglihatan :

  1. Mata memfokuskan bayangan pada retina,
  2. System syaraf mata yang memberi informasi ke otak,
  3. Korteks penglihatan salah satu bagian yang menganalisa penglihatan tersebut.

 

  1. Pembentukan Bayangan Pada Mata

Mata bisa melihat benda jika cahaya yang dipantulkan benda sampai pada mata dengan cukup, kemudian lensa mata akan membentuk bayangan yang bersifat nyata, terbalik dan diperkecil pada retina. Ada tiga komponen penginderaan penglihatan, yaitu:

  1. Mata memfokuskan bayangan pada retina
  2. Sistem saraf mata yang member informasi ke otak
  3. Korteks penglihatan salah satu bagian yang menganalisa penglihatan tersebut

Cahaya memasuki mata melalui bukaan yang berubah, lapisan serat saraf yang menutupi permukaan belakangnya. Retina berisi struktur indra-cahaya yang sangat luas yang disebut batang (rod) dan kerucut (cone) yang menerima dan memancarkan informasi di sepanjang serat saraf optic ke otak. Bentuk lensa kristal dapat diubah sedikit oleh kerja otot siliari. Apabila mata difokuskan pada benda yang jauh, otot akan mengendur dan sistem lensa kornea berada pada panjang fokus maksimumnya, kira-kira 2 cm, jarak dari kornea ke retina. Apabila benda didekatkan, otot siliari akan meningkatkan kelengkungan lensa, yang dengan demikian akan mengurangi panjang fokusnya sehingga bayangan akan difokuskan ke retina. Proses ini disebut akomodasi.

 

  1. Ketajaman Penglihatan

Ketajaman penglihatan digunakan untuk menentukan penggunaan kacamata, di klinik dikenal dengan istilah visus. Sedangkan dalam fisika, ketajaman penglihatan ini disebut resolusi mata.

Visus penderita bukan saja member pengertian tentang optiknya (kacamata), tetapi mempunyai arti yang lebih luas yaitu memberi keterangan mengenai baik buruknya fungsi mata secara keseluruhan. Oleh karena itu definisi visus adalah: nilai kebalikan sudut (dalam menit) terkecil di mana sebuah benda masih dapat dilihat dan dapat dibedakan.

Pada penentuan visus, para ahli mata mempergunakan kartu Snellen, dengan berbagai ukuran huruf dan jarak yang sudah ditentukan. Misalnya mata normal pada waktu diperiksa diperoleh 20/40, berarti penderita dapat membaca huruf pada 20 ft, sedangkan bagi mata normal dapat membaca pada jarak 40 ft, (1 ft = 5 m).

Penggunaan kartu Snellen ini kualitasnya kadang-kadang meragukan oleh karena huruf yang sama besarnya mempunyai derajat kesukaran yang berbeda, demikian pula huruf dengan ukuran berbeda kadang-kadang tidak sama bentuknya. Untuk menghindari kelemahan-kelemahan itu telah diciptakan kartu Cincin Landolt. Kartu ini mempunyai sejumlah cincin berlubang, diatur berderet yang sama besar, dengan lubang yang arahnya ke atas, ke bawah, ke kiri dan ke kanan. Dari atas ke bawah cincin itu diatur agar lubangnya mengecil secara berangsur-angsur. Penderita disuruh menunjukan deretan cincin tersebut hingga cincin terkecil tanpa salah. Angka visus ini dapat didapat dengan menghitung sudut di mana cincin Landolt itu diamati. Misalnya penderita menunjukan cincin Landolt tanpa salah 0,8 mm jarak 4 meter.

 

  1. Medan Penglihatan

Untuk mengetahui besar kecilnya medan penglihatan seseorang dipergunakan alat Perimeter. Dengan alat ini diperoleh medan penglihatan vertikal 130º, sedangkan medan penglihatan horizontal 155º.

 

  1. Tanggap Cahaya

Bagian mata yang tanggap cahaya adalah retina. Ada dua tipe fotoreseptor pada retina yaitu Rod (batang) dan Cone (kerucut). Rod dan Cone tidak terletak pada permukaan retina melainkan beberapa lapis di belakang jaringan saraf. Tiap mata memiliki 6,5 juta cone yang berfungsi untuk melihat siang hari, disebut penglihatan fotopik. Melalui cone kita dapat mengenal beberapa warna, tetapi hanya sensitive terhadap warna kuning, hijau (panjang gelombang 550 nm). Cone terdapat terutama pada fovea sentralis.

Rod dipergunakan pada waktu malam atau disebut penglihatan skotopik, dan merupakan ketajaman penglihatan dan dipergunakan untuk melihat ke samping. Setiap mata terdapat 120 juta rod. Distribusi pada retina tidak merata, pada sudut 20º terdapat kepadatan yang maksimal. Batang ini sangat peka terhadap cahaya biru dan hijau (510 nm).

Tetapi rod dan cone sama-sama peka terhadap cahaya merah (650-700 nm), tetapi penglihatan cone lebih baik terhadap cahaya merah jika dibandingkan dengan rod.

 

  1. Penyesuaian Terhadap Terang dan Gelap

Dari ruang gelap masuk ke ruangan terang kurang mengalami kesulitan dalam penglihatan. Tetapi apabila dari ruangan terang masuk ke dalam ruangan gelap akan tampak kesulitan dalam penglihatan dan diperlukan waktu agar memperoleh penyesuaian.

Apabila kepekaan retina cukup besar, seluruh objek/benda akan merangsang rod secara maksimum sehingga setiap benda bahkan yang gelap pun akan terlihat terang putih. Tetapi apabila kepekaan retina sangat lemah, ketika masuk ke dalam ruangan gelap tidak ada bayangan yang benderang yang merangsang rod dengan akibat tidak ada suatu objek pun yang terlihat. Perubahan sensitivitas retina secara automatis ini dikenal sebagai fenomena penyesuaian terang dan gelap.

  1. Mekanisme Penyesuaian Terang (Cahaya)

Pada kerucut dan batang terjadi perubahan di bawah pengaruh energy sinar yang disebut foto kimia. Di bawah pengaruh foto kimia ini rhodopsin akan pecah, masuk ke dalam retina dan skotopsine. Retina akan tereduksi menjadi vitamin A di bawah pengaruh enzim alcohol dehydrogenase dan koenzym DPN-H + H+ (=DNA) dan terjadi proses timbale balik (visa verasa).

Rushton (1955) telah membuktikan adanya rhodopsin dalam retina mata manusia, ternyata konsentrasi rhodopsin sesuai dengan distribusi rod. Penyinaran dengan energi cahaya yang besar dan dilakukan secara terus menerus, konsentrasi rhodopsin di dalam rod akan sangat menurun sehingga kepekaan retina terhadap cahaya akan menurun.

  1. Mekanisme Penyesuaian Gelap

Seseorang masuk ke dalam ruangan gelap yang tadinya berada di ruangan terang, jumlah rhodopsin di dalam rod sangat sedikit sebagai akibat orang tersebut tidak dapat melihat objek/benda di ruang gelap. Selama berada di ruangan gelap, pembentukan rhodopsin di dalam rod sangatlah perlahan-lahan, konsentrasi rhodopsin akan mencapai kadar yang cukup dalam beberapa menit berikutnya sehingga akhirnya rod akan terangsang oleh cahaya dalam waktu singkat.

Selama penyesuaian gelap, kepekaan retina akan meningkat mencapai nilai 1.000 hanya dalam waktu beberapa menit saja.kepekaan retina mencapai 1.000, waktu yang diperlukan 1 jam. Sedangkan kepekaan retina akan menurun dari nilai 100.000 apabila seseorang dari ruangan gelap ke ruangan terang. Proses penurunan kepekaan retina hanya diperlukan waktu 1 sampai 10 menit. Penyesuaian gelap ini ternyata cone lebih cepat daripada rod. Dalam waktu kira-kira 5 menit fovea sentralis telah mencapai tingkat kepekaan. Kemudian dilanjutkan penyesuaian gelap oleh rod sekitar 30 sampai 60 menit, rata-rata terjadi pada 15 menit pertama.

  1. TanggapWarna

Salah satu kemampuan mata adalah tanggap warna, namun mekanisme tanggap warna tersebut belum diketahui secara jelas. Tetapi dengan menggunakan pengamatan fotopik dapat melihat warna namun tidak dapat membedakan warna pada objek yang letaknya jauh dari pusat medan penglihatan.

Teori Tanggap Warna

Cone berbeda dengan rod dalam beberapa hal, yaitu cone member jawaban yang selektif terhadap warna, kurang sensitif terhadap cahaya dan mempunyai hubungan dengan otak dalam kaitan ketajaman penglihatan dibandingkan dengan rod. Ahli faal Lamonov, Young Helmholtz berpendapat ada tiga tipe cone yang tanggap terhadap tiga warna pokok yaitu biru, hijau dan merah.

  1. a.      Cone biru, mempunyai kemampuan tanggap gelombang frekuensi cahaya antara 400-500 millimikron. Berarti cone biru dapat menerima cahaya ungu, biru dan hijau.
  2. b.      Cone hijau, berkemampuan menerima gelombang cahaya dengan frekuensi antara 450 dan 675 millimikron. Ini berarti cone hijau dapat mendeteksi warna biru, hijau, kuning, orange dan merah.
  3. Cone merah, dapat mendeteksi seluruh panjang gelombang cahaya tetapi respon terhadap cahaya orange kemerahan sangat kuat daripada warna-warna lainnya.

            Ketiga warna pokok (biru, hijau dan merah) disebut trikhromatik.

  1.  Buta Warna

Jika seseorang tidak mempunyai cone merah, ia masih dapat melihat warna hijau, kuning orange dan warna merah dengan menggunakan cone hijau, tetapi tidak dapat membedakan secara tepat antara masing-masing warna tersebut oleh karena tidak mempunyai cone merah untuk kontras/membandingkan dengan cone hijau. Demikian pula jika seseorang kekurangan cone hijau, ia masih dapat melihat seluruh warna, tetapi tidak dapat membedakan antara warna hijau, kuning, oranye dan merah. Hal ini disebabkan cone hijau yang sedikit tidak mampu mengkontraskan dengan cone merah. Jadi tidak adanya cone merah atau hijau akan timbul kesukaran atau ketidakmampuan untuk membedakan warna antara warna merah dan hijau, keadaan ini disebut buta warna merah-hijau. Kasus yang jarang sekali, tetapi bisa jadi seseorang kekurangan cone biru, maka orang tersebut sukar membedakan warna ungu, biru dan hijau. Tipe buta warna ini disebut kelemahan biru (blue weakness).

Pada suatu penelitian diperoleh 8% laki-laki buta warna, sedangkan 0,5% terdapat pada wanita dan dikatakan buta warna ini diturunkan oleh wanita. Ada pula orang buta terhadap warna merah disebut protanopia, buta terhadap warna hijau disebut deuteranopia dan buta warna terhadap warna biru disebut tritanopia.

  1. Daya Akomodasi

Dalam hal memfokuskan objek pada retina, lensa mata memegang peranan penting. Kornea mempunyai fungsi memfokuskan objek secara tepat, demikian pula bola mata yang berdiameter 20-23 mm. Kemampuan lensa mata untuk memfokuskan objek disebut daya akomodasi. Selama mata melihat jauh, tidak terjadi akomodasi. Makin dekat benda yang dilihat, semakin kuat mata/lensa berakomodasi. Daya akomodasi ini tergantung kepada umur. Usia semakin tua daya akomodasi semakin menurun, hal ini disebabkan kekenyalan/elastisitas lensa semakin berkurang.

Jika benda terlalu dekat ke mata, lensa mata tidak dapat memfokuskan cahaya pada retina dan bayangannya menjadi kabur. Titik terdekat di mana lensa mata memfokuskan suatu bayangan pada retina disebut titik dekat (punctum proksimum). Pada saat ini mata berakomodasi sekuat-kuatnya (berakomodasi maksimum). Jarak dari mata ke titik dekat ini sangat beragam pada tiap orang dan berubah dengan meningkatnya usia. Pada usia 10 tahun, titik dekat dapat sedekat 7 cm, sementara pada usia 60 tahun titik dekat ini telah menjauh ke 200 cm karena kehilangan keluwesan lensa akibat elastisitas lensa semakin berkurang, disebut mata presbyop atau mata tua dan bukan merupakan cacat mata. Nilai standar yang diambil untuk titik dekat ini adalah 25 cm, dan dianggap sebagai mata normal.

Jarak terjauh benda agar dapat dilihat dengan jelas, dikatakan benda terletak pada titik jauh (punctum remotum). Pada saat ini mata tidak berakomodasi.lepas akomodasi.

 

  1. Jenis-jenis Mata dan Teknik Koreksi
    1. 1.      Mata Normal

Sering disebut juga mata emetrop. Mata normal memiliki titik dekat 25 cm dan titik jauh tak terhingga. Apabila mata memiliki titik dekat tidak sama dnegan 25 cm dan titik jauh tidak sama dengan tak terhingga, maka dikatakan sebagai cacat mata. Hal ini mengakibatkan mata sulit melihat benda yang jauh maupun dekat karena bayangan tidak jatuh tepat pada retina.

  1. 2.      Rabun Jauh (Miopi)

Disebut juga mata terang dekat, memiliki titik dekat kurang dari 25 cm (< 25 cm) dan titik jauh pada jarak tertentu. Orang yang menderita miopi dapat melihat dengan jelas benda pada jarak 25 cm, tetapi tidak dapat melihat benda jauh dengan jelas. Hal ini terjadi karena lensa mata tidak dapat menjadi piph sebagaimana mestinya sehingga bayangan benda jatuh di depan retina, disebabkan karena mata dibiasakan melihat benda dengan jarak dekat atau kurang dari 25 cm. cacat mata ini dapat diatasi dengan memakai kacamata berlensa cekung (minus).

  1. 3.      Rabun Dekat (Hipermetropi)

Rabun dekat memiliki titik dekat lebih dari 25 cm (> 25 cm), dan titik jauhnya pada jarak tak terhingga. Penderita rabun dekat dapat melihat jelas benda-benda yang sangat jauh tetapi tidak dapat melihat benda-benda dekat dnegan jelas. Hal ini terjadi karena lensa mata tidak dapat menjadi cembung sebagaimana mestinya sehingga bayangan benda jatuh di belakang retina, disebabkan karena mata dibiasakan melihat benda yang jaraknya jauh. Cacat mata ini dapat diatasi dengan kacamata berlensa cembung (plus).

  1. 4.      Mata Tua (Presbiopi)

Jenis mata ini bukan termasuk cacat mata, disebabkan oleh daya akomodasi yang berkurang akibat bertambah usia. Letak titik dekat maupun titik jauh telah bergeser. Titik dekatnya lebih dari 25 cm dan titik jauhnya hanya pada jarak tertentu. Pada penderita presbiopi tidak dapat melihat benda jauh dengan jelas serta tidak dapat membaca pada jarak baca normal. Jenis mata ini dapat ditolong dengan kacamata berlensa rangkap (minus di atas dan plus di bawah) yang disebut kacamata bifocal.

  1. 5.      Astigmatisma

Cacat mata ini disebabkan oleh kornea mata yang tidak berbentuk sferis, tapi lebih melengkung pada satu sisi daripada sisi yang lain. Akibatnya sebuah titik akan difokuskan sebagai garis pendek. Penderita astagmatisma, dengan satu mata akan melihat garis dalam satu arah lebih jelas daripada kea rah yang berlawanan. Penderita astagmatisma dapat diatasi dnegan menggunakan kacamata berlensa silindris.

  1. 6.      Mata Campuran

Penderita yang matanya sekaligus mengalami prsesbiopi dan miopi, maka memiliki titik dekat yang letaknya terlalu jauh dan titik jauh terlalu kecil, dapat ditolong dengan kacamata berlensa rangkap atau bifocal (negatif di atas dan positif di bawah).

 

  1.  Peralatan Dalam Pemeriksaan Mata

Dari sekian banyak peralatan mata, hanya beberapa peralatan yang akan dibahas dalam kaitan pemeriksaan mata. Ada tiga prinsip dalam pemeriksaan mata yaitu : pemeriksaaan mata bagian dalam, pengukuran daya focus mata, pengukuran kelengkungan kornea. Peralatan dalam pemeriksaan mata dan lensa ada 6 macam yaitu :

  1. Opthalmoskop
  2. Retinoskop
  3. Keratometer
  4. Tonometer dari schiotz
  5. Pupilometer
  6.  Lensometer

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

  1. C.     

 

  1. D.    Perawatan alat-alat keperawatan

 

      Macam-macam peralatan

  1. 1.      Peralatan elektronika

Peralatan yang mempergunakan sumber daya listrik, misalnya alat electrocardiography, electro encephalograpy, unit thermograpy, ventilator, unit monitor EKG, dll.

Perawatan : peralatan ini sangat peka terhadap goncangan. Hindari penggunaan peralatan dari medan magnet yang kuat agar sensitivitas meter tidak berubah. Alat-alat elektronika tidak tahan pada suhu diatas 25 derajat C, sebaiknya berkisar antara 18 derajat s/d 25 derajat C, rata-rata pada temperature 21 derajat C. Untuk menghindari suhu terlalu tinggi, pada alat perlu tempati kipas angin di sekitar power supply/sumber daya alat tersebut. Debu dapat pula mempengaruhi kerjanya alat, sehingga setiap saat ruangan dibersihkan dengan menggunakan alat penyedot debu. Pengetahuan dan ketrampilan penggunaan peralatan memegang peranan penting dalam perawatan peralatan agar peralatan berjalan dengan baik dan kerusakan dapat dihindari sejauh mungkin.  

  1. 2.      Peralatan dari bahan baku logam

 

Bahan baku logam yang biasa dipakai adalah nikel, alpaca, tembaga, dan logam campuran lainnya. Peralatan dari bahan logam ini banyak ragamnya, misalnya forcep ekstraksi, gunting, pinset, jarum hecting, dll.

 

Perawatan : alat-alat harus disimpan pada tempat yang mempunyai temperature tinggi (kurang lebih 37 derajat C) dan lingkungan yang kering kalau perlu memakai bahan silicon sebagai penyerap uap air. Sebelum disimpan alat tersebut harus bebas dari kotoran debu maupun air yang melekat, kemudian diolesi dengan minyak olie, minyak rem atau paraffin cair.

 

  1. 3.      Peralatan dari bahan baku gelas

 

Bahan baku gelas yang biasa dipakai adalah pyrex, fiber gelas. Contoh : vakum extractive/ekstraksi vakum, pipet, tabung reaksi, buret, dll.

 

Perawatan :

Keuntungannya : bahan gelas tahan terhadap reaksi kimia, terutama bahan gelas pyrex, tahan terhadap perubahan temperature yang mendadak, koefisien muai yang kecil dan tembus cahaya yang besar.

 

Kelemahannya : mudah pecah terhadap tekanan mekanik, dan mudah tumbuh jamur sehingga mengganggu daya tembus sinar ; kadang-kadang dengan menggunakan kain katun untuk membersihkan saja mudah timbul goresan.

 

 

 

Harus diperhatikan bahwa :

  1. Penyimpanan pada ruangan yang suhunya berkisar 27 derajat C-37 derajat C dan diberi tambahan lampu 25 watt.
  2. Ruangan tempat penyimpanan diberi bahan silicon sebagai zat higroskopis.
  3. Gunakan alcohol, aceton, kapas, sikat halus dan pompa angin untuk membersihkan debu dari permukaan kaca/gelas. Usahakan pada waktu membersihkan lensa jangan sampai merusak lapisan lensa.
  4. Pada waktu memanaskan tabung reaksi hendaknya ditempatkan diatas kawat kasa ; atau boleh melakukan pemanasan secara langsung asalkan bahan gelas terbuat dari pyrex.
  5. Gelas yang akan direbus hendaknya jangan dimasukkan langsung kedalam air yang sedang mendidih melainkan gelas dimasukkan kedalam air dingin kemudian dipanaskan secara perlahan-lahan. Sebaliknya untuk pendinginan mendadak tidak diperkenankan.
  6. Membersihkan bahan/kotoran dari gelas sebaiknya segera setelah dipakai dapat menggunakan :
  • Air yang bersih
    • Detergent : dapat menghilangkan lemak dan tidak membawa   efek perubahan fisik
    • Larutan : kalium dichromat     10 gram

   Asam belerang         25 ml

   Aquadest                  75 ml

 

  1. 4.      Peralatan dari bahan baku karet/plastik

 

Perawatan : bersihkan kotoran darah atau cairan obat dengan cara mencuci dengan sabun kemudian dikeringkan dengan menjemur dibawah sinar matahari atau hembusan udara hangat. Setelah itu taburi talk pada seluruh permukaan karet.

 

STERILISASI

 

Suatu proses membunuh segala bentuk kehidupan mikro organism yang ada dalam sample/contoh, alat-alat lingkungan tertentu.

 

Tehnik sterilisasi pada dasarnya dapat ditempuh melalui dua cara :

  1. Secara fisis
  2. Secara kimia

 

  1. A.    STERILISASI SECARA FISIS
    1. a.      Metode  radiasi

Sinar matahari banyak mengandung sinar ultraviolet, sehingga secara langsung dapat dipakai untuk proses sterilisasi; hal ini telah lama diketahui orang. Sinar ultraviolet bisa diperoleh dengan menggunakan katoda panas (emisi termis) yaitu ke dalam tabung katoda bertekanan rendah diisi dengan uap air raksa; panjang gelombang yang dihasilkan dalam proses ini biasanya dalam orde 2.500 s/d 2.600 Angstrom. Dalam proses sterilisasi hendaknya memperhatikan dosis ultraviolet. Sinar gamma mempunyai tenaga yang lebih besar daripada sinar ultraviolet dan merupakan radiasi pengion. Interaksi antara sinar gamma dengan materi biologis sangat tinggi sehingga mampu memukul electron pada kulit atom sehingga menghasilkan pasangan ion. Cairan sel baik intraselluler maupun ekstraselluler akan terionisasi sehingga menyebabkan kerusakan dan kematian pada mikro organism tersebut.

 

Sterilisasi dengan penyinaran sinar gamma berdaya tinggi dipergunakan untuk objek-objek yang tertutup plastic. Untuk makanan maupun obat-obatan tidak boleh menggunakan sinar gamma untuk sterilisasi oleh karena akan terjadi perubahan struktur kimia pada makanan maupun obat-obatan tersebut.

 

  1. b.      Metode pemanasan dengan uap air dan pengaruh tekanan (autu clave)

 

Benda yang akan disuci hamakan diletakkan di atas lempengan saringan dan tidak langsung mengenai air dibawahnya. Pemanasan dilakukan hingga air mendidih (diperkirakan pada suhu 100 derajat C), pada tekanan 15 lb temperature mencapai 121 derajat C. organisme yang tidak berspora dapat dimatikan dalam tempo 10 menit saja.

 

  1. c.       Metode  pemanasan secara kering

Untuk mencapai efektifitas diperlukan pemanasan mencapai temperature antara 160 derajat C s/d 180 derajat C. Pada temperature ini akan menyebabkan kerusakan pada sel-sel hidup dan jaringan; hal ini disebabkan terjadinya auto oksidasi sehingga bakteri pathogen dapat terbakar. Pada temperatur 160 derajat C memerlukan waktu 1 jam, sedangkan pada temperature 180 derajat C memerlukan waktu 30 menit. Secara rutin dipergunakan untuk mensterilisasikan alat-alat pipet, tabung reaksi, stick swab, jarum operasi, jarum suntik, syringe. Hindarilah tindakan sterilisasi dengan metode panas kering terhadap jarum dan gunting.

 

 

 

  1. Metode pemanasan secara intermittent/terputus-putus

John tyndall (1877) memperoleh dari hasil penelitiannya bahwa pada temperature didih (100 derajat C) selam 1 jam tidak dapat membunuh semua mikroorganisme tetapi apabila air dididihkan berulang-ulang sampai lima kali dan setiap air mendidih istirahat berlangsung untuk membunuh kuman.

  1. Metode incineration (pembakaran langsung)

Alat-alat platina, khrome yang akan disterilisasi dapat dilakukan melalui pembakaran secara langsung pada nyala lampu bunzen hingga mencapai merah padam. Hanya saja dalam proses pembakaran langsung ini alat-alat tersebut lama-kelamaan menjadi rusak. Keuntungannya : mikroorganisme akan hancur semuanya.

  1. Metode penyaringan (filtration)

Sterilisasi dengan metode pemanasan dapat membunuh mikroorganisme tetapi mikroorganisme yang mati tetap berada pada material tersebut, sedangkan sterilisasi dengan metode penyaringan mikroorganisme tetap hidup hanya dipisahkan dari material. Bahan filter/penyaringan adalah sejenis porselin yang berpori yang dibuat khusus dari masing-masing pabrik

 

Ada banyak macam filter yaitu :

  1. Berkefeld V
  2. Coarse N, M, dan W
  3. Fine
  4. Chamberland
  5. Seitz
  6. Sintered glass

Metode filtrasi ini hanya dipakai untuk sterilisasi larutan gula, cairan lain seperti serum atau sterilisasi hasil produksi mikroorganisme seperti enzyme dan exotoxin dan untuk memisahkan fitrable virus dari bacteria dan organism lain.

  1. B.     STERILISASI SECARA KIMIA

 

Sterilisasi secara kimia tidak dibahas secara terperinci di sini, namun lazim digunakan adalah alcohol 96 %, Aceton tab formalin, sulfur dioxide dan chlorine. Materi yang akan disucihamakan dibersihkan terlebih dahulu kemudian direndam dalam alcohol atau aceton atau tab formalin selama kurang lebih 24 jam.

 

       PELAKSANAAN STERILISASI

Sterilisasi dapat terlaksana sesuai dengan tujuan yang diinginkan yaitu mikroorganisme dapat dibunuh dan peralatan tetap baik, untuk itu perlu mengetahui :

  1. Macam peralatan manakah yang akan disuci hamakan
  2. Metode sterilisasi manakah yang akan dipakai

 

ü  STERILISASI TERHADAP BAHAN BAKU LOGAM DAN GELAS

Alat yang terbuat dari logam sebelum disteril dicuci terlebih dahulu. Perbiasakan segera mencuci alat-alat begitu selesai memakainya, agar kotoran yang melengket mudah dibersihkan.

Alat-alat logam (jarum, suntik, pinset, gunting, jarum operasi, scalpel blede) maupun tabung reaksi, pipet, petridisk, mula-mula dibersihkan terdahulu kemudian dibungkus dengan kain gaas. Setelah itu menggunakan metode pemanasan secara kering, suhu mencapai 160 derajat C, jarak waktu mencapai 1-2 jam, kemudian didiamkan agar suhu turun perlahan-lahan.

 

ü  STERILISASI TERHADAP BAHAN BAKU KAIN DAN MEDIA KULTUR

Media kultur yang akan disteril, terlebih dahulu dibungkus dengan kertas agar setelah disteril dan dikeluarkan dari alat steriisator tidak terkontaminasi dengan kuman lagi. Demikian pula kain doek, dibungkus dengan plastic terlebih dahulu sebelum melakukan sterilisasi. Metode sterilisasi yang akan dipakai disini adalah metode pemanasan dengan uap air dan pengaruh tekanan (autoclave). Pertukaran antara oksigen dan karbondioksida.

 

ü  STERILISASI BAHAN BAKU DARI KARET/PLASTIK

Bahan karet misalnya sarung tangan apabila akan disterilkan sebaiknya jangan memakai metode pemanasan, oleh karena akan mengganggu elastisitas karet dan karet akan meleleh apabila kena panas. Untuk mensuci hama bahan baku karet, mula-mula dibersihkan dari kotoran dengan memakai air bersih dan detergent, kemudian dikeringkan. Setelah itu taburi talk dan disimpan dengan menggunakan tablet formalin. 

                       

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

DAFTAR ISI

  1. F. J. Gabriel ,1996, “Fisika Kedokteran” Jakarta : EGCS
Posted on by azwarajuar | Leave a comment
  1. Perkembanganseksualitas

Perkembanganseksmanusiadibedakanmenjadi:

  1. a.      TahapOral :Mencapaiumursekitar 1-2 tahun, tingkatkepuasanseksdicapaidenganmenghisap: putingsusuibu, dot botol, jaritangan. Dengandemikianbayibarudapattidursetelahdisusuiolehibu. Olehkarenaituperilakudemikiantidakperludilarang.
  2. b.      TahapAnal :Kepuasanseksanakdidapatmemaluirangsanganabussaatbuang air besar, antaraumur 3-4 tahunseringduduk lama di toilet, sehinggakepuasannyatercapai.
  3. c.       TahapFalik :Terjadisekitarumur 4-5 tahun, denganjalanmempermainkanalatkelaminnya.
  4. d.      Tahaplaten :Terjadisekitarumur 6-12 tahun. tingkahlakuseksualseolah-olahterbenam, karenamungkinlebihbanyakbermain, sekolah, danadanyapekerjaanrumahdarisekolah. Sehinggaanakcepatlelahdanlekastertidur, untuksiapbangunpagidansekolahkembali.
  5. e.       Tahapgenital :Umursekitar 12-15 tahun. Tandasekssekundermulaiberkembangdankeinginanseksdalambentuk libido mulaitampakdanterusberlanjutsampaiusialanjut. Suaramulaiberubah, keinginandipujadanmemujamulaimuncul, keinginanbercumbudandicumbu pun mulaitampak. Saatituadalahmasa yang berbahaya, sehinggamemerlukanperhatiankhususdari orang tua. Padawanitatelahmulaidatangbulan (menstruasi) danpriamulaimimpibasahsehinggadapatmenyebabkankehamilanatauhamilbilamerekamelakukanhubunganseksual. Karenakematanganjiwadanjasmanibelummencapaitingkatdewasa, sehinggabilaerjadikehamilan yang tidakdikehendaki, memberikandampakkejiwaan yang menyedihkan.

 

  1. Penyimpanganseksualitas

Penyimpangan seksual adalah aktivitas seksual yang ditempuh seseorang untuk mendapatkan kenikmatan seksual dengan tidak sewajarnya. Biasanya, cara yang digunakan oleh orang tersebut adalah menggunakan obyek seks yang tidak wajar. Penyebab terjadinya kelainan ini bersifat psikologis atau kejiwaan, seperti pengalaman sewaktu kecil, dari lingkungan pergaulan, dan faktor genetik. Berikut ini macam-macam bentuk penyimpangan seksual
a. Homoseksual
Homoseksual merupakan kelainan seksual berupa disorientasi pasangan seksualnya. Disebut gay bila penderitanya laki-laki dan lesbi untuk penderita perempuan. Hal yang memprihatinkan disini adalah kaitan yang erat antara homoseksual dengan peningkatan risiko AIDS. Pernyataan ini dipertegas dalam jurnal kedokteran Amerika (JAMA tahun 2000), kaum homoseksual yang “mencari” pasangannya melalui internet, terpapar risiko penyakit menular seksual (termasuk AIDS) lebih tinggi dibandingkan mereka yang tidak.

b. Sadomasokisme
Sadisme seksual termasuk kelainan seksual. Dalam hal ini kepuasan seksual diperoleh bila mereka melakukan hubungan seksual dengan terlebih dahulu menyakiti atau menyiksa pasangannya. Sedangkan masokisme seksual merupakan kebalikan dari sadisme seksual. Seseorang dengan sengaja membiarkan dirinya disakiti atau disiksa untuk memperoleh kepuasan seksual.

c. Ekshibisionisme
Penderita ekshibisionisme akan memperoleh kepuasan seksualnya dengan memperlihatkan alat kelamin mereka kepada orang lain yang sesuai dengan kehendaknya. Bila korban terkejut, jijik dan menjerit ketakutan, ia akan semakin terangsang. Kondisi begini sering diderita pria, dengan memperlihatkan penisnya yang dilanjutkan dengan masturbasi hingga ejakulasi.

d.Voyeurisme
Istilah voyeurisme (disebut juga scoptophilia) berasal dari bahasa Prancis yakni vayeur yang artinya mengintip. Penderita kelainan ini akan memperoleh kepuasan seksual dengan cara mengintip atau melihat orang lain yang sedang telanjang, mandi atau bahkan berhubungan seksual. Setelah melakukan kegiatan mengintipnya, penderita tidak melakukan tindakan lebih lanjut terhadap korban yang diintip. Dia hanya mengintip atau melihat, tidak lebih. Ejakuasinya dilakukan dengan cara bermasturbasi setelah atau selama mengintip atau melihat korbannya. Dengan kata lain, kegiatan mengintip atau melihat tadi merupakan rangsangan seksual bagi penderita untuk memperoleh kepuasan seksual. Yang jelas, para penderita perilaku seksual menyimpang sering membutuhkan bimbingan atau konseling kejiwaan, disamping dukungan orang-orang terdekatnya agar dapat membantu mengatasi keadaan mereka.

e.Fetishisme
Fatishi berarti sesuatu yang dipuja. Jadi pada penderita fetishisme, aktivitas seksualnya disalurkan melalui bermasturbasi dengan BH (breast holder), celana dalam, kaos kaki, atau benda lain yang dapat meningkatkan hasrat atau dorongan seksual. Sehingga, orang tersebut mengalami ejakulasi dan mendapatkan kepuasan. Namun, ada juga penderita yang meminta pasangannya untuk mengenakan benda-benda favoritnya, kemudian melakukan hubungan seksual yang sebenarnya dengan pasangannya tersebut.

f. Pedophilia / Pedophil / Pedofilia / Pedofil
Adalah orang dewasa yang yang suka melakukan hubungan seks / kontak fisik yang merangsang dengan anak di bawah umur.

g.Bestially
Bestially adalah manusia yang suka melakukan hubungan seks dengan binatang seperti kambing, kerbau, sapi, kuda, ayam, bebek, anjing, kucing, dan lain sebagainya.

h.Incest
Adalah hubungan seks dengan sesama anggota keluarga sendiri non suami istri seperti antara ayah dan anak perempuan dan ibu dengna anak cowok

i.Necrophilia/Necrofil
Adalah orang yang suka melakukan hubungan seks dengan orang yang sudah menjadi mayat / orang mati.

j.Zoophilia
Zoofilia adalah orang yang senang dan terangsang melihat hewan melakukan hubungan seks dengan hewan.

k.Sodomi
Sodomi adalah pria yang suka berhubungan seks melalui dubur pasangan seks baik pasangan sesama jenis (homo) maupun dengan pasangan perempuan.

l.Frotteurisme/Frotteuris
Yaitu suatu bentuk kelainan sexual di mana seseorang laki-laki mendapatkan kepuasan seks dengan jalan menggesek-gesek / menggosok-gosok alat kelaminnya ke tubuh perempuan di tempat publik / umum seperti di kereta, pesawat, bis, dll.

m.Gerontopilia
adalah suatu perilaku penyimpangan seksual dimana sang pelaku jatuh cinta dan mencari kepuasan seksual kepada orang yang sudah berusia lanjut (nenek-nenek atau kakek-kakek). Gerontopilia termasuk dalam salah satu diagnosis gangguan seksual, dari sekian banyak gangguan seksual seperti voyurisme, exhibisionisme, sadisme, masochisme, pedopilia, brestilia, homoseksual, fetisisme, frotteurisme, dan lain sebagainya. Keluhan awalnya adalah merasa impoten bila menghadapi istri/suami sebagai pasangan hidupnya, karena merasa tidak tertarik lagi. Semakin ia didesak oleh pasangannya maka ia semakin tidak berkutik, bahkan menjadi cemas. Gairah seksualnya kepada pasangan yang sebenarnya justru bisa bangkit lagi jika ia telah bertemu dengan idamannya (kakek/nenek).

Manusia itu diciptakan Tuhan sebagai makhkluk sempurna, sehingga mampu mencintai dirinya (autoerotik), mencintai orang lain beda jenis (heteroseksual) namun juga yang sejenis (homoseksual) bahkan dapat jatuh cinta makhluk lain ataupun benda, sehingga kemungkinan terjadi perilaku menyimpang dalam perilaku seksual amat banyak. Manusia walaupun diciptakanNya sempurna namun ada keterbatasan, misalnya manusia itu satu-satunya makhluk yang mulut dan hidungnya tidak mampu menyentuh genetalianya; seandainya dapat dilakukan mungkin manusia sangat mencintai dirinya secara menyimpang pula. Hal itu sangat berbeda dengan hewan, hampir semua hewan mampu mencium dan menjilat genetalianya, kecuali Barnobus (sejenis Gorilla) yang sulit mencium genetalianya. Barnobus satu-satunya jenis apes (monyet) yang bila bercinta menatap muka pasangannya, sama dengan manusia. Hewanpun juga banyak yang memiliki penyimpangan perilaku seksual seperti pada manusia, hanya saja mungkin variasinya lebih sedikit, misalnya ada hewan yang homoseksual, sadisme, dan sebagainya.

Kasus Gerontopilia mungkin jarang terdapat dalam masyarakat karena umumnya si pelaku malu untuk berkonsultasi ke ahli, dan tidak jarang mereka adalah anggota masyarakat biasa yang juga memiliki keluarga (anak & istri/suami) serta dapat menjalankan tugas-tugas hidupnya secara normal bahkan kadang-kadang mereka dikenal sebagai orang-orang yang berhasil/sukses dalam karirnya. Meski jarang ditemukan, tidaklah berarti bahwa kasus tersebut tidak ada dalam masyarakat Indonesia.

 

 

  1. Faktor-faktor yang mempengaruhiseksualitas

 

 

  1. 1.       FaktorKlien

Dapatmengalamipenurunankeinginanseksualkarenaalasanfisik, karenabagamanapunaktivitasseksbisamenimbulkannyeridanketidaknyamanan. Kondisifisikdapatberupapenyakitringan/berat, keletihan, medikasimaupuncitratubuh. Citra tubuh yang buruk, terutamadisertaipenolakanataupembedahan yang mengubahbentuktubuhmenyebabkanseseorangkehilangangairah.

 

  1. 2.       FaktorHubungan

Masalahdalamberhubungan (kemesraan, kedekatan) dapatmempengaruhihubunganseseoranguntukmelakukanaktivitasseksual. Hal inisebenarnyatergantungdaribagimanakemampuanmerekadalamberkompromidanbernegosiasimengenaiperilakuseksual yang dapatditerimadanmenyenangkan

 

  1. 3.       Faktor Gaya Hidup

Gaya hidupdisinimeliputipenyalahgunaanalkoholdalamaktivitasseks, ketersediaanwaktuuntukmencurahkanperasaandalamberhubungan, danpenentuanwaktu yang tepatuntukaktivitasseks.Penggunaanalkoholdapatmenyebabkan rasa sejahteraataugairahpalsudalamtahapawalseksdenganefeknegatif yang jauhlebihbesardibandingperasaaneforiapalsutersebut.Sebagianklienmungkintidakmengetahuibagaimanmengaturwaktuantarabekerjadenganaktivitasseksual, sehinggapasangan yang sudahmerasalelahbekerjamerasakalauaktivitasseksmerupakanbebanbaginya.

 

  1. 4.       FaktorHargaDiri

Jikaharga-diriseksualtidakdipeliharadenganmengembangkanperasaan yang kuattentangseksual-diridandenganmempelajariketrampilanseksual, aktivitasseksualmungkinmenyebabkanperasaannegatifatautekananperasaanseksual.

 

Hargadiriseksualdapattergangguolehbeberapahalantara lain: perkosaan, inses, penganiayaanfisik/emosi, ketidakadekuatanpendidikanseks, pengaharapanpribadiataukultural yang tidakrealistik. Sedangkanfaktor-faktor yang mempengaruhiperilakuseksual, menurutPurnawan (2004) yang dikutipdariberbagaisumberantara lain:

 

Faktor Internal

 

1)       Tingkat perkembanganseksual (fisik/psikologis)

Perbedaankematanganseksualakanmenghasilkanperilakuseksual yang berbeda pula. Misalnyaanak yang berusia 4-6 tahunberbedadengananak 13 tahun.

 

2). Pengetahuanmengenaikesehatanreproduksi

Anak yang memilikipemahamansecarabenardanproporsionaltentangkesehatanreproduksicenderungmemahamiresikoperilakusertacaraalternatif yang dapatdigunakanuntukmenyalurkandoronganseksualnya

 

3). TujuanMotivasi.

Perilakumanusiapadadasarnyaberorientasipada n atautermotivasiuntukmemperolehtujuantertentu. Hersey & Blanchard citRusmiati (2001) perilakuseksualseseorangmemilikitujuanuntukmemperolehkesenangan, mendapatkanperasaanamandanperlindungan, atauuntukmemperolehuang (pada gigolo/WTS)

 

b. FaktorEksternal

1) Keluarga

MenurutWahyudi (2000) kurangnyakomunikasisecaraterbukaantara orang tuadenganremajadapatmemperkuatmunculnyaperilaku yang menyimpang

2)       Pergaulan

Menurut Hurlock perilakuseksualsangatdipengaruhiolehlingkunganpergaulannya, terutamapadamasapubertas/remajadimanapengaruhtemansebayalebihbesardibandingkanorangtuanyaatauanggotakeluarga lain.

Posted on by azwarajuar | Leave a comment

Hello world!

Welcome to WordPress.com! This is your very first post. Click the Edit link to modify or delete it, or start a new post. If you like, use this post to tell readers why you started this blog and what you plan to do with it.

Happy blogging!

Posted in Uncategorized | 1 Comment